Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ACRV1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit ACRV1 Polyclonal Antibody | anti-ACRV1 antibody

ACRV1 antibody - N-terminal region

Gene Names
ACRV1; SP-10; SPACA2; D11S4365
Reactivity
Guinea Pig, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACRV1; Polyclonal Antibody; ACRV1 antibody - N-terminal region; anti-ACRV1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS
Sequence Length
265
Applicable Applications for anti-ACRV1 antibody
Western Blot (WB)
Homology
Guinea Pig: 79%; Human: 100%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACRV1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ACRV1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-ACRV1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-ACRV1 antibody
This is a rabbit polyclonal antibody against ACRV1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its alternative splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.
Product Categories/Family for anti-ACRV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
56
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
acrosomal protein SP-10 isoform a
NCBI Official Synonym Full Names
acrosomal vesicle protein 1
NCBI Official Symbol
ACRV1
NCBI Official Synonym Symbols
SP-10; SPACA2; D11S4365
NCBI Protein Information
acrosomal protein SP-10
UniProt Protein Name
Acrosomal protein SP-10
Protein Family
UniProt Gene Name
ACRV1
UniProt Entry Name
ASPX_HUMAN

NCBI Description

This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2010]

Research Articles on ACRV1

Similar Products

Product Notes

The ACRV1 acrv1 (Catalog #AAA3211391) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACRV1 antibody - N-terminal region reacts with Guinea Pig, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ACRV1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACRV1 acrv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNRFLLLMSL YLLGSARGTS SQPNELSGSI DHQTSVQQLP GEFFSLENPS. It is sometimes possible for the material contained within the vial of "ACRV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.