Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FAM175AAntibody Dilution: 1.0ug/mlSample Type: 293T cell lysate)

Rabbit ABRAXAS1 Polyclonal Antibody | anti-ABRAXAS1 antibody

ABRAXAS1 Antibody - C-terminal region

Gene Names
ABRAXAS1; ABRA1; CCDC98; FAM175A
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ABRAXAS1; Polyclonal Antibody; ABRAXAS1 Antibody - C-terminal region; anti-ABRAXAS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFG
Sequence Length
409
Applicable Applications for anti-ABRAXAS1 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 79%; Horse: 100%; Human: 100%; Pig: 79%; Rabbit: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FAM175AAntibody Dilution: 1.0ug/mlSample Type: 293T cell lysate)

Western Blot (WB) (Host: RabbitTarget Name: FAM175AAntibody Dilution: 1.0ug/mlSample Type: 293T cell lysate)
Related Product Information for anti-ABRAXAS1 antibody
This is a rabbit polyclonal antibody against FAM175A. It was validated on Western Blot

Target Description: This gene encodes a protein that binds to the C-terminal repeats of breast cancer 1 (BRCA1) through a phospho-SXXF motif. The encoded protein recruits ubiquitin interaction motif containing 1 protein to BRCA1 protein and is required for DNA damage resistance, DNA repair, and cell cycle checkpoint control. Pseudogenes of this gene are found on chromosomes 3 and 8. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ABRAXAS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
BRCA1-A complex subunit Abraxas 1 isoform 1
NCBI Official Synonym Full Names
abraxas 1, BRCA1 A complex subunit
NCBI Official Symbol
ABRAXAS1
NCBI Official Synonym Symbols
ABRA1; CCDC98; FAM175A
NCBI Protein Information
BRCA1-A complex subunit Abraxas 1
UniProt Protein Name
BRCA1-A complex subunit Abraxas
UniProt Gene Name
FAM175A
UniProt Synonym Gene Names
ABRA1; CCDC98
UniProt Entry Name
F175A_HUMAN

NCBI Description

This gene encodes a protein that binds to the C-terminal repeats of breast cancer 1 (BRCA1) through a phospho-SXXF motif. The encoded protein recruits ubiquitin interaction motif containing 1 protein to BRCA1 protein and is required for DNA damage resistance, DNA repair, and cell cycle checkpoint control. Pseudogenes of this gene are found on chromosomes 3 and 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]

Uniprot Description

Abraxas: Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it acts as a central scaffold protein that assembles the various components of the BRCA1-A complex and mediates the recruitment of BRCA1. Belongs to the FAM175 family. Abraxas subfamily.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 4q21.23

Cellular Component: nucleus

Molecular Function: protein binding; polyubiquitin binding

Biological Process: positive regulation of DNA repair; double-strand break repair; chromatin modification; response to ionizing radiation; G2/M transition DNA damage checkpoint

Research Articles on ABRAXAS1

Similar Products

Product Notes

The ABRAXAS1 fam175a (Catalog #AAA3216729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABRAXAS1 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ABRAXAS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABRAXAS1 fam175a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDRWQFKRSR LLDTQDKRSK ADTGSSNQDK ASKMSSPETD EEIEKMKGFG. It is sometimes possible for the material contained within the vial of "ABRAXAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.