Western Blot (WB)
(ABHD13 antibody (MBS5300007) used at 1 ug/ml to detect target protein.)
Rabbit ABHD13 Polyclonal Antibody | anti-ABHD13 antibody
ABHD13 antibody
Gene Names
ABHD13; BEM46L1; C13orf6; bA153I24.2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
ABHD13; Polyclonal Antibody; ABHD13 antibody; Polyclonal ABHD13; Anti-ABHD13; RP11-153I24.2; bA153I24.2; FLJ14906; MGC27058; BEM46L1; C13orf6; Abhydrolase Domain Containing 13; anti-ABHD13 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
ABHD13 antibody was raised against the C terminal of ABHD13
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABHD13 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
201
Applicable Applications for anti-ABHD13 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
ABHD13 antibody was raised using the C terminal of ABHD13 corresponding to a region with amino acids LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(ABHD13 antibody (MBS5300007) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(ABHD13 antibody (MBS5300007) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ABHD13 antibody
Rabbit polyclonal ABHD13 antibody raised against the C terminal of ABHD13
Product Categories/Family for anti-ABHD13 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
38 kDa (MW of target protein)
NCBI Official Full Name
ABHD13 protein
NCBI Official Synonym Full Names
abhydrolase domain containing 13
NCBI Official Symbol
ABHD13
NCBI Official Synonym Symbols
BEM46L1; C13orf6; bA153I24.2
NCBI Protein Information
alpha/beta hydrolase domain-containing protein 13
UniProt Protein Name
Alpha/beta hydrolase domain-containing protein 13
Protein Family
UniProt Gene Name
ABHD13
UniProt Synonym Gene Names
C13orf6; Abhydrolase domain-containing protein 13
UniProt Entry Name
ABHDD_HUMAN
Uniprot Description
ABHD13: Belongs to the serine esterase family.
Protein type: EC 3.-.-.-; Membrane protein, integral; Hydrolase
Chromosomal Location of Human Ortholog: 13q33.3
Cellular Component: membrane; integral to membrane
Molecular Function: hydrolase activity
Biological Process: metabolic process
Research Articles on ABHD13
Similar Products
Product Notes
The ABHD13 abhd13 (Catalog #AAA5300007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABHD13 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ABHD13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ABHD13 abhd13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABHD13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
