Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ABHD12 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)

Rabbit ABHD12 Polyclonal Antibody | anti-ABHD12 antibody

ABHD12 antibody - middle region

Gene Names
ABHD12; PHARC; ABHD12A; BEM46L2; C20orf22; dJ965G21.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ABHD12; Polyclonal Antibody; ABHD12 antibody - middle region; anti-ABHD12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH
Sequence Length
398
Applicable Applications for anti-ABHD12 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 80%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ABHD12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ABHD12 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-ABHD12 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)
Related Product Information for anti-ABHD12 antibody
This is a rabbit polyclonal antibody against ABHD12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ABHD12 has 2-arachidonoylglycerol hydrolase activity.ABHD12 may be a regulator of endocannabinoid signaling pathways.
Product Categories/Family for anti-ABHD12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
monoacylglycerol lipase ABHD12 isoform a
NCBI Official Synonym Full Names
abhydrolase domain containing 12
NCBI Official Symbol
ABHD12
NCBI Official Synonym Symbols
PHARC; ABHD12A; BEM46L2; C20orf22; dJ965G21.2
NCBI Protein Information
monoacylglycerol lipase ABHD12
UniProt Protein Name
Monoacylglycerol lipase ABHD12
Protein Family
UniProt Gene Name
ABHD12
UniProt Synonym Gene Names
C20orf22
UniProt Entry Name
ABD12_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jan 2011]

Uniprot Description

ABHD12: Has 2-arachidonoylglycerol hydrolase activity. May be a regulator of endocannabinoid signaling pathways. Defects in ABHD12 are the cause of polyneuropathy hearing loss ataxia retinitis pigmentosa and cataract (PHARC). PHARC is a slowly progressive neurologic disorder with a variable phenotype resembling Refsum disease. Clinical features include sensorineural hearing loss, visual problems related to cataracts, retinitis pigmentosa, pes cavus, ataxic and/or spastic gait disturbances with a progressive sensorimotor peripheral neuropathy. Other features include hyporeflexia, hyperreflexia, extensor plantar responses. Belongs to the serine esterase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.1.23; Hydrolase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 20p11.21

Cellular Component: integral to membrane

Molecular Function: acylglycerol lipase activity

Biological Process: phosphatidylserine catabolic process; adult walking behavior; acylglycerol catabolic process

Disease: Polyneuropathy, Hearing Loss, Ataxia, Retinitis Pigmentosa, And Cataract

Research Articles on ABHD12

Similar Products

Product Notes

The ABHD12 abhd12 (Catalog #AAA3207598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABHD12 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ABHD12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABHD12 abhd12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPLLILHAED DPVVPFQLGR KLYSIAAPAR SFRDFKVQFV PFHSDLGYRH. It is sometimes possible for the material contained within the vial of "ABHD12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.