Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Researcher: Dr. Hao Zhu, University of Kansas Medical CenterApplication: Western blottingSpecies + Tissue/Cell type: Mouse liver extractHow many ug's of tissue/cell lysate run on the gel:1. 60 ug mouse liver extract2. 60 ug mouse liver extract3. 60 ug mouse liver extractPrimary antibody dilution: 1:500Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:3000)

Rabbit ABCE1 Polyclonal Antibody | anti-ABCE1 antibody

ABCE1 antibody - C-terminal region

Gene Names
ABCE1; RLI; OABP; RLI1; ABC38; RNS4I; RNASEL1; RNASELI
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ABCE1; Polyclonal Antibody; ABCE1 antibody - C-terminal region; anti-ABCE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
Sequence Length
599
Applicable Applications for anti-ABCE1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ABCE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Researcher: Dr. Hao Zhu, University of Kansas Medical CenterApplication: Western blottingSpecies + Tissue/Cell type: Mouse liver extractHow many ug's of tissue/cell lysate run on the gel:1. 60 ug mouse liver extract2. 60 ug mouse liver extract3. 60 ug mouse liver extractPrimary antibody dilution: 1:500Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:3000)

Western Blot (WB) (Researcher: Dr. Hao Zhu, University of Kansas Medical CenterApplication: Western blottingSpecies + Tissue/Cell type: Mouse liver extractHow many ug's of tissue/cell lysate run on the gel:1. 60 ug mouse liver extract2. 60 ug mouse liver extract3. 60 ug mouse liver extractPrimary antibody dilution: 1:500Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:3000)

Western Blot (WB)

(WB Suggested Anti-ABCE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateABCE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-ABCE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateABCE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-ABCE1 antibody
This is a rabbit polyclonal antibody against ABCE1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
ATP-binding cassette sub-family E member 1
NCBI Official Synonym Full Names
ATP binding cassette subfamily E member 1
NCBI Official Symbol
ABCE1
NCBI Official Synonym Symbols
RLI; OABP; RLI1; ABC38; RNS4I; RNASEL1; RNASELI
NCBI Protein Information
ATP-binding cassette sub-family E member 1
UniProt Protein Name
ATP-binding cassette sub-family E member 1
Protein Family
UniProt Gene Name
ABCE1
UniProt Synonym Gene Names
RLI; RNASEL1; RNASELI; RNS4I; RNS4I

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCE1: Antagonizes the binding of 2-5A (5'-phosphorylated 2',5'-linked oligoadenylates) by RNase L through direct interaction with RNase L and therefore inhibits its endoribonuclease activity. May play a central role in the regulation of mRNA turnover. Antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. May act as a chaperone for post-translational events during HIV-1 capsid assembly. Belongs to the ABC transporter superfamily. ABCE family.

Chromosomal Location of Human Ortholog: 4q31.21

Cellular Component: cytoplasm; eukaryotic translation initiation factor 3 complex; membrane; mitochondrial matrix; mitochondrion

Molecular Function: ATP binding; iron ion binding; protein binding; ribosomal small subunit binding

Biological Process: ribosome export from nucleus; translational initiation; translational termination; transmembrane transport

Research Articles on ABCE1

Similar Products

Product Notes

The ABCE1 abce1 (Catalog #AAA3206969) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABCE1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ABCE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABCE1 abce1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAGMNKFLSQ LEITFRRDPN NYRPRINKLN SIKDVEQKKS GNYFFLDD. It is sometimes possible for the material contained within the vial of "ABCE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.