Rabbit AARS Polyclonal Antibody | anti-AARS antibody

AARS antibody - C-terminal region

Cat. Num. AAA3205178

• Gene Names: AARS; CMT2N; EIEE29
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: AARS; Polyclonal Antibody; AARS antibody - C-terminal region; anti-AARS antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT
• Sequence Length: 968

• Applicable Applications for anti-AARS antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AARS
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-AARS AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in cell processes of pinealocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-AARS AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC)

(Rabbit Anti-AARS antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Host: RabbitTarget Name: AARSSample Type: JurkatAntibody Dilution: 1.0ug/mlAARS is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB)

(WB Suggested Anti-AARS Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateAARS is supported by BioGPS gene expression data to be expressed in Jurkat)

Related Product Information for anti-AARS antibody

This is a rabbit polyclonal antibody against AARS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure. The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.

Product Categories/Family for anti-AARS antibody

Polyclonal; RNA Binding Proteins; Chromatin & Nuclear Signaling

NCBI and Uniprot Product Information

• NCBI GI #: 109148542
• NCBI GeneID: 16
• NCBI Accession #: NP_001596
• NCBI GenBank Nucleotide #: NM_001605
• UniProt Accession #: P49588
• Molecular Weight: 107kDa
• NCBI Official Full Name: alanine--tRNA ligase, cytoplasmic
• NCBI Official Synonym Full Names: alanyl-tRNA synthetase
• NCBI Official Symbol: AARS
• NCBI Official Synonym Symbols: CMT2N; EIEE29
• NCBI Protein Information: alanine--tRNA ligase, cytoplasmic
• UniProt Protein Name: Alanine--tRNA ligase, cytoplasmic
• UniProt Gene Name: AARS
• UniProt Entry Name: SYAC_HUMAN

NCBI Description

The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure. [provided by RefSeq, Jul 2008]

Uniprot Description

AARS: Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala- AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain. Defects in AARS are the cause of Charcot-Marie-Tooth disease type 2N (CMT2N). It is an axonal form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathies(designated CMT1 when they are dominantly inherited) and primary peripheral axonal neuropathies (CMT2). Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Nerve conduction velocities are normal or slightly reduced. Belongs to the class-II aminoacyl-tRNA synthetase family.

Protein type: RNA-binding; Ligase; EC 6.1.1.7; Translation

Chromosomal Location of Human Ortholog: 16q22

Cellular Component: membrane; cytoplasm; cytosol

Molecular Function: amino acid binding; zinc ion binding; ATP binding; alanine-tRNA ligase activity; tRNA binding

Biological Process: protein folding; unfolded protein response; tRNA processing; regulation of translational fidelity; cerebellar Purkinje cell layer development; tRNA modification; response to amino acid stimulus; tRNA aminoacylation for protein translation; hair follicle development; gene expression; negative regulation of neuron apoptosis; neuromuscular process controlling balance; alanyl-tRNA aminoacylation

Disease: Epileptic Encephalopathy, Early Infantile, 29; Charcot-marie-tooth Disease, Axonal, Type 2n