Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AADAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

Rabbit AADAT Polyclonal Antibody | anti-AADAT antibody

AADAT antibody - middle region

Gene Names
AADAT; KAT2; KATII; KYAT2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AADAT; Polyclonal Antibody; AADAT antibody - middle region; anti-AADAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI
Sequence Length
425
Applicable Applications for anti-AADAT antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AADAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AADAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-AADAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)
Related Product Information for anti-AADAT antibody
This is a rabbit polyclonal antibody against AADAT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathw
Product Categories/Family for anti-AADAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
kynurenine/alpha-aminoadipate aminotransferase, mitochondrial isoform b
NCBI Official Synonym Full Names
aminoadipate aminotransferase
NCBI Official Symbol
AADAT
NCBI Official Synonym Symbols
KAT2; KATII; KYAT2
NCBI Protein Information
kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
UniProt Protein Name
Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
UniProt Gene Name
AADAT
UniProt Synonym Gene Names
KAT2; KAT/AadAT; AadAT
UniProt Entry Name
AADAT_HUMAN

NCBI Description

This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]

Uniprot Description

AADAT: Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino- group acceptors, with a preference for 2-oxoglutarate, 2- oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro). Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.6.1.7; Amino Acid Metabolism - tryptophan; EC 2.6.1.39; Amino Acid Metabolism - lysine degradation; Transferase; Amino Acid Metabolism - lysine biosynthesis; Mitochondrial

Chromosomal Location of Human Ortholog: 4q33

Cellular Component: mitochondrial matrix

Molecular Function: protein homodimerization activity; kynurenine-oxoglutarate transaminase activity; 2-aminoadipate transaminase activity; pyridoxal phosphate binding

Biological Process: glutamate metabolic process; tryptophan catabolic process to kynurenine; L-lysine catabolic process to acetyl-CoA via saccharopine; lysine catabolic process; biosynthetic process; tryptophan catabolic process; 2-oxoglutarate metabolic process

Research Articles on AADAT

Similar Products

Product Notes

The AADAT aadat (Catalog #AAA3206919) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AADAT antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AADAT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AADAT aadat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIYELARKYD FLIIEDDPYY FLQFNKFRVP TFLSMDVDGR VIRADSFSKI. It is sometimes possible for the material contained within the vial of "AADAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.