DNA-directed RNA polymerase III subunit RPC4 (Polr3d) Recombinant Protein | Polr3d recombinant protein
Recombinant Mouse DNA-directed RNA polymerase III subunit RPC4 (Polr3d)
Gene Names
Polr3d; RPC4; 44kDa; BN51T; TSBN51; AI326118; AW489084; 2810426M17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA-directed RNA polymerase III subunit RPC4 (Polr3d); Recombinant Mouse DNA-directed RNA polymerase III subunit RPC4 (Polr3d); Polr3d recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-398, full length protein
Sequence
SEGNAAGEPSNPGGPRPLLSGGRGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDMSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQLPLAHSGWLFKEESEEPEAKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAARKTPGLPKDVSVAELLRELSLMKDEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVVIKQEKDREARLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
Sequence Length
397
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Polr3d recombinant protein
This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,357 Da
NCBI Official Full Name
DNA-directed RNA polymerase III subunit RPC4
NCBI Official Synonym Full Names
polymerase (RNA) III (DNA directed) polypeptide D
NCBI Official Symbol
Polr3d
NCBI Official Synonym Symbols
RPC4; 44kDa; BN51T; TSBN51; AI326118; AW489084; 2810426M17Rik
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC4
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC4
UniProt Gene Name
Polr3d
UniProt Synonym Gene Names
Bn51t; RNA polymerase III subunit C4
Uniprot Description
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway ().
Similar Products
Product Notes
The Polr3d polr3d (Catalog #AAA1482167) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-398, full length protein. The amino acid sequence is listed below: SEGNAAGEPS NPGGPRPLLS GGRGLIGRRP APPLTPGRLP SIRSRDLTLG GVKKKTFTPN IISRKIKEEP KEEVTMKKEK RERDRDRQRE GHGRGRGRPE VIQSHSIFEQ GPAEMMKKKG NWDKTVDMSD MGPSHIINIK KEKRETDEET KQILRMLEKD DFIDDPGLKN DTRNMPVQLP LAHSGWLFKE ESEEPEAKPF SAGPKEEDME VDVPAVKVKE EPRDEEEEAK VKAPPRAARK TPGLPKDVSV AELLRELSLM KDEELLFLQL PDTLPGQPPT QDIKPVKTEV QGEDGQMVVI KQEKDREARL AENACTLADL TEGQVGKLLI RKSGKVQLLL GKVTLDVTMG TTCSFLQELV SVGLGDSRTG EMTVLGHVKH KLVCSPDFES LLDHKHR. It is sometimes possible for the material contained within the vial of "DNA-directed RNA polymerase III subunit RPC4 (Polr3d), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
