DNA-directed RNA polymerase II subunit RPB4 (POLR2D) Recombinant Protein | POLR2D recombinant protein

Recombinant Human DNA-directed RNA polymerase II subunit RPB4 (POLR2D)

Cat. Num. AAA1038380

• Gene Names: POLR2D; RBP4; RPB16; HSRBP4; HSRPB4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA-directed RNA polymerase II subunit RPB4 (POLR2D); Recombinant Human DNA-directed RNA polymerase II subunit RPB4 (POLR2D); POLR2D recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-142, Full length protein
• Sequence: MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
• Sequence Length: 142

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for POLR2D recombinant protein

This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3 untranslated region of the transcript from this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 4758574
• NCBI GeneID: 5433
• NCBI Accession #: NP_004796.1
• NCBI GenBank Nucleotide #: NM_004805.3
• UniProt Accession #: O15514; Q52LT4
• Molecular Weight: 16,311 Da
• NCBI Official Full Name: DNA-directed RNA polymerase II subunit RPB4
• NCBI Official Synonym Full Names: RNA polymerase II subunit D
• NCBI Official Symbol: POLR2D
• NCBI Official Synonym Symbols: RBP4; RPB16; HSRBP4; HSRPB4
• NCBI Protein Information: DNA-directed RNA polymerase II subunit RPB4
• UniProt Protein Name: DNA-directed RNA polymerase II subunit RPB4
• UniProt Gene Name: POLR2D
• UniProt Synonym Gene Names: RNA polymerase II subunit B4; RPB16

NCBI Description

This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double-stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA ().