Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNA-directed RNA polymerase II subunit RPB1 (Polr2a) Recombinant Protein | Polr2a recombinant protein

Recombinant Mouse DNA-directed RNA polymerase II subunit RPB1 (Polr2a), partial

Gene Names
Polr2a; Rpb1; 220kDa; Rpo2-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA-directed RNA polymerase II subunit RPB1 (Polr2a); Recombinant Mouse DNA-directed RNA polymerase II subunit RPB1 (Polr2a); partial; Recombinant Mouse DNA-directed RNA polymerase II subunit RPB1 (Polr2a) (His tagged); DNA-directed RNA polymerase II subunit RPB1; RNA polymerase II subunit B1; EC=2.7.7.6; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase III largest subunit; Polr2a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1593-1960aa; Partial, provide the C-terminal domain (CTD) Domain (the C-terminal domain (CTD)serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing.)
Sequence
YSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPA
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
217,176 Da
NCBI Official Full Name
DNA-directed RNA polymerase II subunit RPB1
NCBI Official Synonym Full Names
polymerase (RNA) II (DNA directed) polypeptide A
NCBI Official Symbol
Polr2a
NCBI Official Synonym Symbols
Rpb1; 220kDa; Rpo2-1
NCBI Protein Information
DNA-directed RNA polymerase II subunit RPB1; RNA polymerase II 1; RNA polymerase II subunit B1; DNA-directed RNA polymerase II A; DNA-directed RNA polymerase II subunit A; DNA-directed RNA polymerase III largest subunit
UniProt Protein Name
DNA-directed RNA polymerase II subunit RPB1
UniProt Gene Name
Polr2a
UniProt Synonym Gene Names
Rpii215; Rpo2-1; RNA polymerase II subunit B1
UniProt Entry Name
RPB1_MOUSE

Similar Products

Product Notes

The Polr2a polr2a (Catalog #AAA949587) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1593-1960aa; Partial, provide the C-terminal domain (CTD) Domain (the C-terminal domain (CTD)serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing.). The amino acid sequence is listed below: YSPTSPAYEP RSPGGYTPQS PSYSPTSPSY SPTSPSYSPT SPNYSPTSPS YSPTSPSYSP TSPSYSPTSP SYSPTSPSYS PTSPSYSPTS PSYSPTSPSY SPTSPSYSPT SPSYSPTSPS YSPTSPSYSP TSPSYSPTSP SYSPTSPSYS PTSPNYSPTS PNYTPTSPSY SPTSPSYSPT SPNYTPTSPN YSPTSPSYSP TSPSYSPTSP SYSPSSPRYT PQSPTYTPSS PSYSPSSPSY SPTSPKYTPT SPSYSPSSPE YTPASPKYSP TSPKYSPTSP KYSPTSPTYS PTTPKYSPTS PTYSPTSPVY TPTSPKYSPT SPTYSPTSPK YSPTSPTYSP TSPKGSTYSP TSPGYSPTSP TYSLTSPA. It is sometimes possible for the material contained within the vial of "DNA-directed RNA polymerase II subunit RPB1 (Polr2a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.