Podocalyxin (PODXL) Recombinant Protein | PODXL recombinant protein

Recombinant Human Podocalyxin (PODXL), partial

Cat. Num. AAA1131900

• Gene Names: PODXL; PC; PCLP; Gp200; PCLP-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Podocalyxin (PODXL); Recombinant Human Podocalyxin (PODXL); partial; Podocalyxin; GCTM-2 antigen; Gp200; Podocalyxin-like protein 1; PC; PCLP-1; PODXL recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 32-458aa; Partial
• Sequence: QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF
• Sequence Length: 458

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

NCBI and Uniprot Product Information

• NCBI GI #: 66277202
• NCBI GeneID: 5420
• NCBI Accession #: NP_001018121.1
• NCBI GenBank Nucleotide #: NM_001018111.2
• UniProt Accession #: O00592; Q52LZ7; Q53ER6; A6NHX8
• Molecular Weight: 46.2 kDa
• NCBI Official Full Name: podocalyxin isoform 1
• NCBI Official Synonym Full Names: podocalyxin-like
• NCBI Official Symbol: PODXL
• NCBI Official Synonym Symbols: PC; PCLP; Gp200; PCLP-1
• NCBI Protein Information: podocalyxin; GCTM-2 antigen; podocalyxin-like protein 1
• UniProt Protein Name: Podocalyxin
• Protein Family: Podocalyxin
• UniProt Gene Name: PODXL
• UniProt Synonym Gene Names: PCLP; PCLP1; PC; PCLP-1
• UniProt Entry Name: PODXL_HUMAN

NCBI Description

This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. [provided by RefSeq, Jul 2008]

Uniprot Description

PODXL: Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell- cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR- dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells. Belongs to the podocalyxin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q32-q33

Cellular Component: ruffle; extracellular space; lamellipodium; integral to plasma membrane; microvillus membrane; cytoplasm; apical plasma membrane; plasma membrane; filopodium; lipid raft

Molecular Function: protein binding

Biological Process: cell migration; negative regulation of cell adhesion; negative regulation of cell-cell adhesion; cell adhesion; leukocyte migration; positive regulation of cell-cell adhesion mediated by integrin; regulation of microvillus biogenesis; positive regulation of cell migration