Calcium-independent phospholipase A2-gamma (Pnpla8) Recombinant Protein | Pnpla8 recombinant protein
Recombinant Mouse Calcium-independent phospholipase A2-gamma (Pnpla8)
Gene Names
Pnpla8; AI467579; Ipla2(gamma); 1200006O19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-independent phospholipase A2-gamma (Pnpla8); Recombinant Mouse Calcium-independent phospholipase A2-gamma (Pnpla8); Pnpla8 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-776aa; full length protein
Sequence
MSINLTLDIYIYFLNNARSLCGKQRSKQLHFVCSKQYWRMNHVNVHREFHTSKKSCKWNR SEAHCSKHWHSPSNHGLHFGIVRLSTSAPKGLTKVSIHMSRIKSTLNSVSKAIFGSQNEM VTRLAQFKPSSRILRKVSDKGWLKQKNVKQAVESLKNYSDKSAGKNSLAEQKSYFADKEE DSGKHSLFHYTYGITTRFGESFSVLANHINSYFKSKGKMSQTKEDKQLQDKPDLEERKSS SPGPDTVADRPDSESPLEVKDKLSSPTQMPEAHPVSAKQSIANFLSRPTEGVQALVGGYI GGLVPKLKSDPKSPPEEQEVSAKTEQAVNKDKKAEEKKRVLLQQEKIIARVSIDNRTRAL VQALRRTADPKLCITRVEELTFHLLEFPEGKGVAIKEKIIPYLLRLRQVKDETLQAAVRE ILALIGYVDPVKGRGIRILTIDGGGTRGVVALQTLRKLVELTQKPIHQLFDYICGVSTGA ILAFMLGLFHMPLDECEELYRKLGSDVFTQNVIVGTVKMSWSHAFYDSNTWEKILKDRIG SALMIETARNPACPKVAAISTIVNRGQTPKAFVFRNYGHFPGTNSHYLGGCQYKMWQAIR ASSAAPGYFAEYALGSDLHQDGGLLLNNPSALALHECKCIWPDTPLECIVSLGTGRYESD VRNTSTYTSLKTKLSNVISSATDTEEVHIMLDGLLPSDTYFRFNPVICENIPLDESRDEK LDQLQLEGMKYIERNDQKMKKVAKILSQEKTTLQKINDWIKLKSDMYEGLPFFSKL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Pnpla8 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
87,381 Da
NCBI Official Full Name
calcium-independent phospholipase A2-gamma
NCBI Official Synonym Full Names
patatin-like phospholipase domain containing 8
NCBI Official Symbol
Pnpla8
NCBI Official Synonym Symbols
AI467579; Ipla2(gamma); 1200006O19Rik
NCBI Protein Information
calcium-independent phospholipase A2-gamma
UniProt Protein Name
Calcium-independent phospholipase A2-gamma
Protein Family
UniProt Gene Name
Pnpla8
UniProt Synonym Gene Names
Ipla22; Ipla2g; iPLA2-gamma
UniProt Entry Name
PLPL8_MOUSE
Uniprot Description
PNPLA8: Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Phospholipase; EC 3.1.1.5; Membrane protein, integral; Motility/polarity/chemotaxis
Cellular Component: cytoplasm; endoplasmic reticulum; Golgi apparatus; integral to membrane; intracellular; membrane; peroxisomal membrane; peroxisome
Molecular Function: calcium-independent phospholipase A2 activity; hydrolase activity; lysophospholipase activity
Biological Process: arachidonic acid metabolic process; arachidonic acid secretion; cell death; fatty acid metabolic process; linoleic acid metabolic process; lipid catabolic process; lipid metabolic process; metabolic process; phosphatidylethanolamine catabolic process; prostaglandin biosynthetic process
Research Articles on Pnpla8
Similar Products
Product Notes
The Pnpla8 pnpla8 (Catalog #AAA7026826) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-776aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Pnpla8 pnpla8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSINLTLDIY IYFLNNARSL CGKQRSKQLH FVCSKQYWRM NHVNVHREFH TSKKSCKWNR SEAHCSKHWH SPSNHGLHFG IVRLSTSAPK GLTKVSIHMS RIKSTLNSVS KAIFGSQNEM VTRLAQFKPS SRILRKVSDK GWLKQKNVKQ AVESLKNYSD KSAGKNSLAE QKSYFADKEE DSGKHSLFHY TYGITTRFGE SFSVLANHIN SYFKSKGKMS QTKEDKQLQD KPDLEERKSS SPGPDTVADR PDSESPLEVK DKLSSPTQMP EAHPVSAKQS IANFLSRPTE GVQALVGGYI GGLVPKLKSD PKSPPEEQEV SAKTEQAVNK DKKAEEKKRV LLQQEKIIAR VSIDNRTRAL VQALRRTADP KLCITRVEEL TFHLLEFPEG KGVAIKEKII PYLLRLRQVK DETLQAAVRE ILALIGYVDP VKGRGIRILT IDGGGTRGVV ALQTLRKLVE LTQKPIHQLF DYICGVSTGA ILAFMLGLFH MPLDECEELY RKLGSDVFTQ NVIVGTVKMS WSHAFYDSNT WEKILKDRIG SALMIETARN PACPKVAAIS TIVNRGQTPK AFVFRNYGHF PGTNSHYLGG CQYKMWQAIR ASSAAPGYFA EYALGSDLHQ DGGLLLNNPS ALALHECKCI WPDTPLECIV SLGTGRYESD VRNTSTYTSL KTKLSNVISS ATDTEEVHIM LDGLLPSDTY FRFNPVICEN IPLDESRDEK LDQLQLEGMK YIERNDQKMK KVAKILSQEK TTLQKINDWI KLKSDMYEGL PFFSKL. It is sometimes possible for the material contained within the vial of "Calcium-independent phospholipase A2-gamma (Pnpla8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
