Signal transduction protein pmrD (pmrD) Recombinant Protein | pmrD recombinant protein

Recombinant Escherichia coli Signal transduction protein pmrD (pmrD)

Cat. Num. AAA1220674

• Gene Names: pmrD; ECK2253; JW2254
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Signal transduction protein pmrD (pmrD); Recombinant Escherichia coli Signal transduction protein pmrD (pmrD); pmrD recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-88, full length protein
• Sequence: MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAGKTQ
• Sequence Length: 88

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 90111410
• NCBI GeneID: 945130
• NCBI Accession #: NP_416762.2
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P37590; P76475; P77155; Q5MN33; Q5MN36; Q5MN40; Q5MN44; Q5MN45; Q5MN54; Q5MN59; Q5MN60; Q5MN62
• Molecular Weight: 9,871 Da
• NCBI Official Full Name: inactive two-component system connector protein
• NCBI Official Symbol: pmrD
• NCBI Official Synonym Symbols: ECK2253; JW2254
• NCBI Protein Information: inactive two-component system connector protein
• UniProt Protein Name: Signal transduction protein PmrD
• Protein Family: Signal transduction protein
• UniProt Gene Name: pmrD

NCBI Description

In Salmonella but not Escherichia coli, low Mg(2+) PhoP-activated PmrD controls PmrA(BasR)/PmrB(BasS) activity post-translationally by binding to phospho-PmrA(BasR) and inhibiting its dephosphorylation but not its phosphotransfer, connecting the PhoPQ and PmrAB two-component systems and allowing for an amplified and persistent PmrAB response (Kato, 2007). [More information is available at EcoGene: EG12671]. PmrD is similar to the Salmonella enterica serovar Typhimurium PmrD, which confers resistance to polymyxin B when it is overexpressed ; in Salmonella, PmrD controls the activity of the PmrA-PmrB two-component system at a post-transcriptional level . [More information is available at EcoCyc: G7172].

Uniprot Description

Interacts with phosphorylated BasR protein to mediate transcriptional induction of BasR-activated genes to induce polymyxin resistance in some natural isolates.