Western Blot (WB)
(HSPA4 rabbit polyclonal antibody. Western Blot analysis of HSPA4 expression in mouse spleen.)
Rabbit anti-Human, Mouse HSPA4 Polyclonal Antibody | anti-HSPA4 antibody
HSPA4 (Heat Shock 70kD Protein 4, Heat Shock 70-related Protein APG-2, HSP70RY, APG2)
Gene Names
HSPA4; RY; APG-2; HSPH2; hsp70; hsp70RY; HS24/P52
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
HSPA4; Polyclonal Antibody; HSPA4 (Heat Shock 70kD Protein 4; Heat Shock 70-related Protein APG-2; HSP70RY; APG2); Anti -HSPA4 (Heat Shock 70kD Protein 4; anti-HSPA4 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSPA4. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGKELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVFSKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKVKVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIENEGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLYEDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
Applicable Applications for anti-HSPA4 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human HSPA4, aa1-840 (AAI10862.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(HSPA4 rabbit polyclonal antibody. Western Blot analysis of HSPA4 expression in mouse spleen.)
Western Blot (WB)
(HSPA4 rabbit polyclonal antibody. Western Blot analysis of HSPA4 expression in mouse spleen.)
Western Blot (WB)
(HSPA4 rabbit polyclonal antibody. Western Blot analysis of HSPA4 expression in Jurkat.)
Western Blot (WB)
(HSPA4 rabbit polyclonal antibody. Western Blot analysis of HSPA4 expression in Jurkat.)
Western Blot (WB)
(Western Blot analysis of HSPA4 expression in transfected 293T cell line by HSPA4 polyclonal antibody. Lane 1: HSPA4 transfected lysate (94.3kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of HSPA4 expression in transfected 293T cell line by HSPA4 polyclonal antibody. Lane 1: HSPA4 transfected lysate (94.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HSPA4 antibody
HSPA4 was originally suggested to be a member of the heat shock protein 70 family. However it is now known that human HSPA4 is a equivalent to mouse the Apg-2 protein and is a member of the Hsp110 family.
Product Categories/Family for anti-HSPA4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
94,331 Da
NCBI Official Full Name
heat shock 70 kDa protein 4
NCBI Official Synonym Full Names
heat shock 70kDa protein 4
NCBI Official Symbol
HSPA4
NCBI Official Synonym Symbols
RY; APG-2; HSPH2; hsp70; hsp70RY; HS24/P52
NCBI Protein Information
heat shock 70 kDa protein 4; hsp70 RY; heat shock 70kD protein 4; heat shock protein, 110 kDa; heat shock 70-related protein APG-2
UniProt Protein Name
Heat shock 70 kDa protein 4
Protein Family
UniProt Gene Name
HSPA4
UniProt Synonym Gene Names
APG2
UniProt Entry Name
HSP74_HUMAN
Uniprot Description
HSP70RY: Interacts with TJP1/ZO-1. Belongs to the heat shock protein 70 family.
Protein type: Heat shock protein; Chaperone
Chromosomal Location of Human Ortholog: 5q31.1
Cellular Component: mitochondrion; cytosol
Molecular Function: ATP binding
Biological Process: chaperone-mediated protein complex assembly; protein import into mitochondrial outer membrane; response to unfolded protein
Research Articles on HSPA4
Similar Products
Product Notes
The HSPA4 hspa4 (Catalog #AAA644138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPA4 (Heat Shock 70kD Protein 4, Heat Shock 70-related Protein APG-2, HSP70RY, APG2) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the HSPA4 hspa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSVVGIDLGF QSCYVAVARA GGIETIANEY SDRCTPACIS FGPKNRSIGA AAKSQVISNA KNTVQGFKRF HGRAFSDPFV EAEKSNLAYD IVQLPTGLTG IKVTYMEEER NFTTEQVTAM LLSKLKETAE SVLKKPVVDC VVSVPCFYTD AERRSVMDAT QIAGLNCLRL MNETTAVALA YGIYKQDLPA LEEKPRNVVF VDMGHSAYQV SVCAFNRGKL KVLATAFDTT LGGRKFDEVL VNHFCEEFGK KYKLDIKSKI RALLRLSQEC EKLKKLMSAN ASDLPLSIEC FMNDVDVSGT MNRGKFLEMC NDLLARVEPP LRSVLEQTKL KKEDIYAVEI VGGATRIPAV KEKISKFFGK ELSTTLNADE AVTRGCALQC AILSPAFKVR EFSITDVVPY PISLRWNSPA EEGSSDCEVF SKNHAAPFSK VLTFYRKEPF TLEAYYSSPQ DLPYPDPAIA QFSVQKVTPQ SDGSSSKVKV KVRVNVHGIF SVSSASLVEV HKSEENEEPM ETDQNAKEEE KMQVDQEEPH VEEQQQQTPA ENKAESEEME TSQAGSKDKK MDQPPQAKKA KVKTSTVDLP IENQLLWQID REMLNLYIEN EGKMIMQDKL EKERNDAKNA VEEYVYEMRD KLSGEYEKFV SEDDRNSFTL KLEDTENWLY EDGEDQPKQV YVDKLAELKN LGQPIKIRFQ ESEERPKLFE ELGKQIQQYM KIISSFKNKE DQYDHLDAAD MTKVEKSTNE AMEWMNNKLN LQNKQSLTMD PVVKSKEIEA KIKELTSTCS PIISKPKPKV EPPKEEQKNA EQNGPVDGQG DNPGPQAAEQ GTDTAVPSDS DKKLPEMDID. It is sometimes possible for the material contained within the vial of "HSPA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
