Probable pectinesterase/pectinesterase inhibitor 35 (PME35) Recombinant Protein | PME35 recombinant protein
Recombinant Arabidopsis thaliana Probable pectinesterase/pectinesterase inhibitor 35 (PME35)
Gene Names
PME61; pectin methylesterase 35; pectin methylesterase 61; PME35
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable pectinesterase/pectinesterase inhibitor 35 (PME35); Recombinant Arabidopsis thaliana Probable pectinesterase/pectinesterase inhibitor 35 (PME35); PME35 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-529, Full length protein
Sequence
HSSNSKFTKISRHPNSDSSSRTKPSTSSNKGFLSSVQLSLDHALFARSLAFNLTLSHRTSQTLMLDPVNDCLELLDDTLDMLYRIVVIKRKDHVNDDVHTWLSAALTNQETCKQSLSEKSSFNKEGIAIDSFARNLTGLLTNSLDMFVSDKQKSSSSSNLTGGRKLLSDHDFPTWVSSSDRKLLEASVEELRPHAVVAADGSGTHMSVAEALASLEKGSGRSVIHLTAGTYKENLNIPSKQKNVMLVGDGKGKTVIVGSRSNRGGWNTYQSATVAAMGDGFIARDITFVNSAGPNSEQAVALRVGSDRSVVYRCSIDGYQDSLYTLSKRQFYRETDITGTVDFIFGNSAVVFQSCNLVSRKGSSDQNYVTAQGRSDPNQNTGISIHNCRITGSTKTYLGRPWKQYSRTVVMQSFIDGSIHPSGWSPWSSNFALKTLYYGEFGNSGPGSSVSGRVSWAGYHPALTLTEAQGFTVSGFIDGNSWLPSTGVVFDSGLL
Sequence Length
495
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,513 Da
NCBI Official Full Name
pectin methylesterase 61
NCBI Official Symbol
PME61
NCBI Official Synonym Symbols
pectin methylesterase 35; pectin methylesterase 61; PME35
NCBI Protein Information
pectin methylesterase 61
UniProt Protein Name
Probable pectinesterase/pectinesterase inhibitor 35
Protein Family
UniProt Gene Name
PME35
UniProt Synonym Gene Names
ARATH35; PE 35; AtPME35
NCBI Description
Encodes PME35, a pectin methylesterase. PME35-mediated demethylesterification of the primary cell wall regulates the mechanical strength of the supporting tissue.
Uniprot Description
Acts in the modification of cell walls via demethylesterification of cell wall pectin.
Research Articles on PME35
Similar Products
Product Notes
The PME35 pme35 (Catalog #AAA1300771) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-529, Full length protein. The amino acid sequence is listed below: HSSNSKFTKI SRHPNSDSSS RTKPSTSSNK GFLSSVQLSL DHALFARSLA FNLTLSHRTS QTLMLDPVND CLELLDDTLD MLYRIVVIKR KDHVNDDVHT WLSAALTNQE TCKQSLSEKS SFNKEGIAID SFARNLTGLL TNSLDMFVSD KQKSSSSSNL TGGRKLLSDH DFPTWVSSSD RKLLEASVEE LRPHAVVAAD GSGTHMSVAE ALASLEKGSG RSVIHLTAGT YKENLNIPSK QKNVMLVGDG KGKTVIVGSR SNRGGWNTYQ SATVAAMGDG FIARDITFVN SAGPNSEQAV ALRVGSDRSV VYRCSIDGYQ DSLYTLSKRQ FYRETDITGT VDFIFGNSAV VFQSCNLVSR KGSSDQNYVT AQGRSDPNQN TGISIHNCRI TGSTKTYLGR PWKQYSRTVV MQSFIDGSIH PSGWSPWSSN FALKTLYYGE FGNSGPGSSV SGRVSWAGYH PALTLTEAQG FTVSGFIDGN SWLPSTGVVF DSGLL. It is sometimes possible for the material contained within the vial of "Probable pectinesterase/pectinesterase inhibitor 35 (PME35), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
