Probable carboxypeptidase PM20D1 (PM20D1) Recombinant Protein | PM20D1 recombinant protein
Recombinant Human Probable carboxypeptidase PM20D1 (PM20D1)
Gene Names
PM20D1; Cps1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable carboxypeptidase PM20D1 (PM20D1); Recombinant Human Probable carboxypeptidase PM20D1 (PM20D1); PM20D1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-502, Full length protein
Sequence
MGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPPFSGLERDGIIYGRGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRISALLQSRGVQLAFIVDEGGFILDDFIPNFKKPIALIAVSEKGSMNLMLQVNMTSGHSSAPPKETSIGILAAAVSRLEQTPMPIIFGSGTVVTVLQQLANEFPFPVNIILSNPWLFEPLISRFMERNPLTNAIIRTTTALTIFKAGVKFNVIPPVAQATVNFRIHPGQTVQEVLELTKNIVADNRVQFHVLSAFDPLPVSPSDDKALGYQLLRQTVQSVFPEVNITAPVTSIGNTDSRFFTNLTTGIYRFYPIYIQPEDFKRIHGVNEKISVQAYETQVKFIFELIQNADTDQEPVSHLHKL
Sequence Length
477
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,544 Da
NCBI Official Full Name
N-fatty-acyl-amino acid synthase/hydrolase PM20D1
NCBI Official Synonym Full Names
peptidase M20 domain containing 1
NCBI Official Symbol
PM20D1
NCBI Official Synonym Symbols
Cps1
NCBI Protein Information
N-fatty-acyl-amino acid synthase/hydrolase PM20D1; probable carboxypeptidase PM20D1
UniProt Protein Name
N-fatty-acyl-amino acid synthase/hydrolase PM20D1
Protein Family
UniProt Gene Name
PM20D1
Uniprot Description
Bidirectional N-fatty-acyl amino acid synthase/hydrolase that regulates the production of N-fatty-acyl amino acids. These metabolites are endogenous chemical uncouplers of mitochondrial respiration. In an UCP1-independent manner, maybe through interaction with mitochondrial transporters, they promote proton leakage into the mitochondrial matrix. Thereby, this secreted protein may indirectly regulate the bodily dissipation of chemical energy as heat through thermogenic respiration.
Similar Products
Product Notes
The PM20D1 pm20d1 (Catalog #AAA1360377) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-502, Full length protein. The amino acid sequence is listed below: MGPRSGEHQR ASRIPSQFSK EERVAMKEAL KGAIQIPTVT FSSEKSNTTA LAEFGKYIHK VFPTVVSTSF IQHEVVEEYS HLFTIQGSDP SLQPYLLMAH FDVVPAPEEG WEVPPFSGLE RDGIIYGRGT LDDKNSVMAL LQALELLLIR KYIPRRSFFI SLGHDEESSG TGAQRISALL QSRGVQLAFI VDEGGFILDD FIPNFKKPIA LIAVSEKGSM NLMLQVNMTS GHSSAPPKET SIGILAAAVS RLEQTPMPII FGSGTVVTVL QQLANEFPFP VNIILSNPWL FEPLISRFME RNPLTNAIIR TTTALTIFKA GVKFNVIPPV AQATVNFRIH PGQTVQEVLE LTKNIVADNR VQFHVLSAFD PLPVSPSDDK ALGYQLLRQT VQSVFPEVNI TAPVTSIGNT DSRFFTNLTT GIYRFYPIYI QPEDFKRIHG VNEKISVQAY ETQVKFIFEL IQNADTDQEP VSHLHKL. It is sometimes possible for the material contained within the vial of "Probable carboxypeptidase PM20D1 (PM20D1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
