Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Urokinase-type plasminogen activator Recombinant Protein | PLAU recombinant protein

Recombinant Human Urokinase-type plasminogen activator

Gene Names
PLAU; ATF; QPD; UPA; URK; u-PA; BDPLT5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Urokinase-type plasminogen activator; Recombinant Human Urokinase-type plasminogen activator; PLAU recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-173aa; Partial
Sequence
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL
Sequence Length
414
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for PLAU recombinant protein
Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Product Categories/Family for PLAU recombinant protein
References
Cloning and expression of the gene for pro-urokinase in Escherichia coli.Holmes W.E., Pennica D., Blaber M., Rey M.W., Guenzler W.A., Steffens G.J., Heyneker H.L.Biotechnology (N.Y.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.3 kDa
NCBI Official Full Name
urokinase-type plasminogen activator isoform 2
NCBI Official Synonym Full Names
plasminogen activator, urokinase
NCBI Official Symbol
PLAU
NCBI Official Synonym Symbols
ATF; QPD; UPA; URK; u-PA; BDPLT5
NCBI Protein Information
urokinase-type plasminogen activator
UniProt Protein Name
Urokinase-type plasminogen activator
UniProt Gene Name
PLAU
UniProt Synonym Gene Names
U-plasminogen activator; uPA
UniProt Entry Name
UROK_HUMAN

NCBI Description

This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

uPA: Specifically cleave the zymogen plasminogen to form the active enzyme plasmin. Defects in PLAU are the cause of Quebec platelet disorder (QPD). QPD is an autosomal dominant bleeding disorder due to a gain-of-function defect in fibrinolysis. Although affected individuals do not exhibit systemic fibrinolysis, they show delayed onset bleeding after challenge, such as surgery. The hallmark of the disorder is markedly increased PLAU levels within platelets, which causes intraplatelet plasmin generation and secondary degradation of alpha-granule proteins. Belongs to the peptidase S1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Protease; Secreted; EC 3.4.21.73; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10q22.2

Cellular Component: cell surface; extracellular region; extracellular space; focal adhesion; plasma membrane

Molecular Function: protein binding; serine-type endopeptidase activity

Biological Process: angiogenesis; blood coagulation; chemotaxis; embryo implantation; fibrinolysis; positive regulation of cell proliferation; positive regulation of smooth muscle cell migration; proteolysis; regulation of cell adhesion mediated by integrin; regulation of receptor activity; regulation of smooth muscle cell migration; response to activity; response to hyperoxia; signal transduction; skeletal muscle regeneration; smooth muscle cell migration; spermatogenesis

Disease: Alzheimer Disease; Quebec Platelet Disorder

Research Articles on PLAU

Similar Products

Product Notes

The PLAU plau (Catalog #AAA1265454) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-173aa; Partial. The amino acid sequence is listed below: SNELHQVPSN CDCLNGGTCV SNKYFSNIHW CNCPKKFGGQ HCEIDKSKTC YEGNGHFYRG KASTDTMGRP CLPWNSATVL QQTYHAHRSD ALQLGLGKHN YCRNPDNRRR PWCYVQVGLK PLVQECMVHD CADGKKPSSP PEELKFQCGQ KTL. It is sometimes possible for the material contained within the vial of "Urokinase-type plasminogen activator, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.