Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zinc finger protein PLAGL1 (PLAGL1) Recombinant Protein | PLAGL1 recombinant protein

Recombinant Human Zinc finger protein PLAGL1 (PLAGL1)

Gene Names
PLAGL1; ZAC; LOT1; ZAC1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein PLAGL1 (PLAGL1); Recombinant Human Zinc finger protein PLAGL1 (PLAGL1); PLAGL1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-463, Full length protein
Sequence
MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQKSHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDLTCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQQQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
Sequence Length
463
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PLAGL1 recombinant protein
This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,668 Da
NCBI Official Full Name
zinc finger protein PLAGL1 isoform 2
NCBI Official Synonym Full Names
PLAG1 like zinc finger 1
NCBI Official Symbol
PLAGL1
NCBI Official Synonym Symbols
ZAC; LOT1; ZAC1
NCBI Protein Information
zinc finger protein PLAGL1
UniProt Protein Name
Zinc finger protein PLAGL1
Protein Family
UniProt Gene Name
PLAGL1
UniProt Synonym Gene Names
LOT1; ZAC; LOT-1

NCBI Description

This gene encodes a C2H2 zinc finger protein that functions as a suppressor of cell growth. This gene is often deleted or methylated and silenced in cancer cells. In addition, overexpression of this gene during fetal development is thought to be the causal factor for transient neonatal diabetes mellitus (TNDM). Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding two different protein isoforms. The P1 downstream promoter of this gene is imprinted, with preferential expression from the paternal allele in many tissues. [provided by RefSeq, Nov 2015]

Uniprot Description

Shows weak transcriptional activatory activity. Transcriptional regulator of the type 1 receptor for pituitary adenylate cyclase-activating polypeptide.

Research Articles on PLAGL1

Similar Products

Product Notes

The PLAGL1 plagl1 (Catalog #AAA1289338) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-463, Full length protein. The amino acid sequence is listed below: MATFPCQLCG KTFLTLEKFT IHNYSHSRER PYKCVQPDCG KAFVSRYKLM RHMATHSPQK SHQCAHCEKT FNRKDHLKNH LQTHDPNKMA FGCEECGKKY NTMLGYKRHL ALHAASSGDL TCGVCALELG STEVLLDHLK AHAEEKPPSG TKEKKHQCDH CERCFYTRKD VRRHLVVHTG CKDFLCQFCA QRFGRKDHLT RHTKKTHSQE LMKESLQTGD LLSTFHTISP SFQLKAAALP PFPLGASAQN GLASSLPAEV HSLTLSPPEQ AAQPMQPLPE SLASLHPSVS PGSPPPPLPN HKYNTTSTSY SPLASLPLKA DTKGFCNISL FEDLPLQEPQ SPQKLNPGFD LAKGNAGKVN LPKELPADAV NLTIPASLDL SPLLGFWQLP PPATQNTFGN STLALGPGES LPHRLSCLGQ QQQEPPLAMG TVSLGQLPLP PIPHVFSAGT GSAILPHFHH AFR. It is sometimes possible for the material contained within the vial of "Zinc finger protein PLAGL1 (PLAGL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.