Zinc finger protein PLAG1 (Plag1) Recombinant Protein | Plag1 recombinant protein
Recombinant Mouse Zinc finger protein PLAG1 (Plag1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein PLAG1 (Plag1); Recombinant Mouse Zinc finger protein PLAG1 (Plag1); Plag1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-499, full length protein
Sequence
MATVIPGDLSEVRDTQKAPSGKRKRGESKPRKNFPCQLCDKAFNSVEKLKVHSFSHTGERPYKCTHQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKSYNTKLGFKRHLALHAATSGDLTCKVCLQNFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCERRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNMSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDAVHPSHHLAFKCPFSSTSYAISIPEKEQPLKGEIESYLMELQGGAPSSSQDSPASSSKLGLEPQSGSPDDGAGDLSLSKSSISISDPLSTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPTQTQDLQDPANTVGLSSLHSLSAAFTSSLSSSTTLPRFHQAFQ
Sequence Length
499
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Plag1 recombinant protein
Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55,579 Da
NCBI Official Full Name
zinc finger protein PLAG1
NCBI Official Synonym Full Names
pleiomorphic adenoma gene 1
NCBI Official Symbol
Plag1
NCBI Protein Information
zinc finger protein PLAG1
UniProt Protein Name
Zinc finger protein PLAG1
Protein Family
UniProt Gene Name
Plag1
Uniprot Description
Transcription factor whose activation results in up-regulation of target genes, such as IGFII, leading to uncontrolled cell proliferation: when overexpressed in cultured cells, higher proliferation rate and transformation are observed. Other target genes such as CRLF1, CRABP2, CRIP2, PIGF are strongly induced in cells with PLAG1 induction. Proto-oncogene whose ectopic expression can trigger the development of pleomorphic adenomas of the salivary gland and lipoblastomas. Cooperates with CBFB-MYH11.
Research Articles on Plag1
Similar Products
Product Notes
The Plag1 plag1 (Catalog #AAA1432855) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-499, full length protein. The amino acid sequence is listed below: MATVIPGDLS EVRDTQKAPS GKRKRGESKP RKNFPCQLCD KAFNSVEKLK VHSFSHTGER PYKCTHQDCT KAFVSKYKLQ RHMATHSPEK THKCNYCEKM FHRKDHLKNH LHTHDPNKET FKCEECGKSY NTKLGFKRHL ALHAATSGDL TCKVCLQNFE STGVLLEHLK SHAGKSSGGV KEKKHQCEHC ERRFYTRKDV RRHMVVHTGR KDFLCQYCAQ RFGRKDHLTR HMKKSHNQEL LKVKTEPVDF LDPFTCNMSV PIKDELLPVM SLPSSELLSK PFTNTLQLNL YNTPFQSMQS SGSAHQMITT LPLGMTCPID MDAVHPSHHL AFKCPFSSTS YAISIPEKEQ PLKGEIESYL MELQGGAPSS SQDSPASSSK LGLEPQSGSP DDGAGDLSLS KSSISISDPL STPALDFSQL FNFIPLNGPP YNPLSVGSLG MSYSQEEAHS SVSQLPTQTQ DLQDPANTVG LSSLHSLSAA FTSSLSSSTT LPRFHQAFQ. It is sometimes possible for the material contained within the vial of "Zinc finger protein PLAG1 (Plag1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
