Secreted Phospholipase A2-IIE Recombinant Protein | PLA2G2E recombinant protein
Recombinant Human Secreted Phospholipase A2-IIE
Gene Names
PLA2G2E; sPLA2-IIE; GIIE sPLA2
Purity
Greater than 95% as determined by SDS PAGE.Ni-NTA affinity chromatography.
Synonyms
Secreted Phospholipase A2-IIE; Recombinant Human Secreted Phospholipase A2-IIE; PLA2G2E Human; Secreted Phospholipase A2-IIE Human Recombinant; Group IIE secretory phospholipase A2; EC 3.1.1.4; Phosphatidylcholine 2-acylhydrolase GIIE; GIIE sPLA2; sPLA(2)-IIE; sPLA2-IIE; PLA2G2E; PLA2G2E recombinant protein
Host
E Coli
Specificity
The amino acid sequence of the recombinant human Secreted Phospholipase A2-IIE is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IIE without signal sequence.
Purity/Purification
Greater than 95% as determined by SDS PAGE.
Ni-NTA affinity chromatography.
Ni-NTA affinity chromatography.
Form/Format
Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
Sterile Filtered lyophilized (freeze-dried) powder.
Sterile Filtered lyophilized (freeze-dried) powder.
Sequence Length
142
Solubility
Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 ug/ml. In higher concentrations the solubility of this antigen is limited.
Preparation and Storage
Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.
Related Product Information for PLA2G2E recombinant protein
Description: Secreted Phospholipase A2-IIE Human Recombinant manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues His-Tag (underlined).MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC.
Introduction: Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
Introduction: Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
Product Categories/Family for PLA2G2E recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15,989 Da
NCBI Official Full Name
group IIE secretory phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2, group IIE
NCBI Official Symbol
PLA2G2E
NCBI Official Synonym Symbols
sPLA2-IIE; GIIE sPLA2
NCBI Protein Information
group IIE secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 2E
UniProt Protein Name
Group IIE secretory phospholipase A2
Protein Family
UniProt Gene Name
PLA2G2E
UniProt Synonym Gene Names
GIIE sPLA2; sPLA2-IIE
UniProt Entry Name
PA2GE_HUMAN
Uniprot Description
PLA2G2E: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a preference for arachidonic-containing phospholipids. Belongs to the phospholipase A2 family.
Protein type: Phospholipase; Secreted, signal peptide; Lipid Metabolism - linoleic acid; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Lipid Metabolism - arachidonic acid; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - ether lipid; Secreted
Chromosomal Location of Human Ortholog: 1p36.13
Cellular Component: extracellular region
Molecular Function: phospholipase A2 activity; calcium ion binding
Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; inflammatory response; lipid catabolic process
Research Articles on PLA2G2E
Similar Products
Product Notes
The PLA2G2E pla2g2e (Catalog #AAA142468) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. It is sometimes possible for the material contained within the vial of "Secreted Phospholipase A2-IIE, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
