Pituitary homeobox 1 (PITX1) Recombinant Protein | PITX1 recombinant protein

Recombinant Human Pituitary homeobox 1 (PITX1)

Cat. Num. AAA963531

• Gene Names: PITX1; BFT; CCF; POTX; PTX1; LBNBG
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Pituitary homeobox 1 (PITX1); Recombinant Human Pituitary homeobox 1 (PITX1); Pituitary homeobox 1; Hindlimb-expressed homeobox protein backfoot; Homeobox protein PITX1; Paired-like homeodomain transcription factor 1; PITX1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-314, Full length protein
• Sequence: MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
• Sequence Length: 314

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for PITX1 recombinant protein

May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.

Product Categories/Family for PITX1 recombinant protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 152963644
• NCBI GeneID: 5307
• NCBI Accession #: NP_002644.4
• NCBI GenBank Nucleotide #: NM_002653.4
• UniProt Accession #: P78337; O14677; O60425; Q9BTI5; A8K3M0; D3DQB0
• Molecular Weight: 35KD
• NCBI Official Full Name: pituitary homeobox 1
• NCBI Official Synonym Full Names: paired-like homeodomain 1
• NCBI Official Symbol: PITX1
• NCBI Official Synonym Symbols: BFT; CCF; POTX; PTX1; LBNBG
• NCBI Protein Information: pituitary homeobox 1; pituitary homeo box 1; homeobox protein PITX1; pituitary otx-related factor; hindlimb expressed homeobox protein backfoot; hindlimb-expressed homeobox protein backfoot; paired-like homeodomain transcription factor 1
• UniProt Protein Name: Pituitary homeobox 1
• Protein Family: Pituitary homeobox
• UniProt Gene Name: PITX1
• UniProt Synonym Gene Names: BFT; PTX1
• UniProt Entry Name: PITX1_HUMAN

NCBI Description

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. [provided by RefSeq, Jul 2008]

Uniprot Description

PITX1: May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb. Defects in PITX1 are a cause of congenital clubfoot (CCF); also known as talipes equinovarus (TEV). Clubfoot is a congenital limb deformity defined as fixation of the foot in cavus, adductus, varus, and equinus (i.e. inclined inwards, axially rotated outwards, and pointing downwards) with concomitant soft tissue abnormalities. Clubfoot may occur in isolation or as part of a syndrome. Clubfoot appears to be a multifactorial trait. Belongs to the paired homeobox family. Bicoid subfamily.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: transcription factor complex; cytoplasm; nucleolus; nucleus

Biological Process: myoblast cell fate commitment; anatomical structure morphogenesis; transcription, DNA-dependent; pituitary gland development; cartilage development; branchiomeric skeletal muscle development; positive regulation of transcription from RNA polymerase II promoter; skeletal development; embryonic hindlimb morphogenesis

Disease: Clubfoot, Congenital, With Or Without Deficiency Of Long Bones And/or Mirror-image Polydactyly; Liebenberg Syndrome