Polyprenol-phosphate-mannose-dependent alpha- (1-2)-phosphatidylinositol pentamannoside mannosyltransferase Recombinant Protein | pimE recombinant protein
Recombinant Mycobacterium smegmatis Polyprenol-phosphate-mannose-dependent alpha- (1-2)-phosphatidylinositol pentamannoside mannosyltransferase, partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Polyprenol-phosphate-mannose-dependent alpha- (1-2)-phosphatidylinositol pentamannoside mannosyltransferase; Recombinant Mycobacterium smegmatis Polyprenol-phosphate-mannose-dependent alpha- (1-2)-phosphatidylinositol pentamannoside mannosyltransferase; partial; pimE recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-410
Sequence
MRVNGYRGAKVGAVDTTSPPEVPASARLQRLAPMLLVVSILARLAWTYLVPNGANFVDLHVYVGGADALDGPGALYDYVYADQTPDFPLPFTYPPFAAIVFYPLHLLPFGVVAFIWQIGIIAALYGVVRVSQRLMGLQSQRRVAMLWTALGIWTEPLRSTFDYGQVNVVLVLAVLCAVSTTRWWLSGLLVGLAAGIKLTPAVAGLYFLGARRWAAVACSAAVFFATVGVSWLVVGAQARRYFTELLGDADRIGPIGTSFNQSWRGGISRILGHDAGFGPLVLIGIGITAVLALLAWRAIGGAQDRLGGILVVSLFGLVLSPISWTHHWVWLIPLMMWLLHGPLSALRGARILGWGWLALTLLGVPWLLSFAQPTIWEIGRPWYLAWAGLVYIVATLATLGWIAFSRKGSG
Sequence Length
410
Species
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,400 Da
NCBI Official Full Name
mannosyltransferase
NCBI Official Symbol
pimE
NCBI Protein Information
mannosyltransferase
UniProt Protein Name
Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase
UniProt Gene Name
pimE
UniProt Synonym Gene Names
Alpha-ManT; PPM alpha-mannosyltransferase
Uniprot Description
Catalyzes the alpha-1,2 addition of a mannose residue from polyprenol-phosphate-mannose (PPM) to a monoacyl phosphatidylinositol pentamannoside (AcPIM5) to generate a monoacyl phosphatidylinositol hexamannoside (AcPIM6).
Research Articles on pimE
Similar Products
Product Notes
The pimE pime (Catalog #AAA1207033) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-410. The amino acid sequence is listed below: MRVNGYRGAK VGAVDTTSPP EVPASARLQR LAPMLLVVSI LARLAWTYLV PNGANFVDLH VYVGGADALD GPGALYDYVY ADQTPDFPLP FTYPPFAAIV FYPLHLLPFG VVAFIWQIGI IAALYGVVRV SQRLMGLQSQ RRVAMLWTAL GIWTEPLRST FDYGQVNVVL VLAVLCAVST TRWWLSGLLV GLAAGIKLTP AVAGLYFLGA RRWAAVACSA AVFFATVGVS WLVVGAQARR YFTELLGDAD RIGPIGTSFN QSWRGGISRI LGHDAGFGPL VLIGIGITAV LALLAWRAIG GAQDRLGGIL VVSLFGLVLS PISWTHHWVW LIPLMMWLLH GPLSALRGAR ILGWGWLALT LLGVPWLLSF AQPTIWEIGR PWYLAWAGLV YIVATLATLG WIAFSRKGSG. It is sometimes possible for the material contained within the vial of "Polyprenol-phosphate-mannose-dependent alpha- (1-2)-phosphatidylinositol pentamannoside mannosyltransferase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
