Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q (PIGQ) Recombinant Protein | PIGQ recombinant protein

Recombinant Human Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q (PIGQ)

Gene Names
PIGQ; GPI1; c407A10.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q (PIGQ); Recombinant Human Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q (PIGQ); PIGQ recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-760aa; full length protein
Sequence
VLKAFFPTCCVSTDSGLLVGRWVPEQSSAVVLAVLHFPFIPIQVKQLLAQVRQASQVGVA VLGTWCHCRQEPEESLGRFLESLGAVFPHEPWLRLCRERGGTFWSCEATHRQAPTAPGAP GEDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRF DEGPVRLSHWQSEGVEASILAELARRASGPICLLLASLLSLVSAVSACRVFKLWPLSFLG SKLSTCEQLRHRLEHLTLIFSTRKAENPAQLMRKANTVASVLLDVALGLMLLSWLHGRSR IGHLADALVPVADHVAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLWISYIHL MSPFVEHILWHVGLSACLGLTVALSLLSDIIALLTFHIYCFYVYGARLYCLKIHGLSSLW RLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLFTILLFLLPTTALYYLVFTLLRLLVVAVQ GLIHLLVDLINSLPLYSLGLRLCRPYRLADKPTALQPRGAHLPPPQLWLPPQALLGRPVP QAVPWGAHLPLEAERGQAGLRELLARLAPPHGHSQPSALPGWHQLSWRMSCALWTLLCAP EHGRPCYHTLGLEVIGSEQMWGWPARLAALHHWHCLPWDPLPTCCGHHGGEHSNPRCPEH CPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAEQ HPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEVAL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PIGQ recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,471 Da
NCBI Official Full Name
phosphatidylinositol N-acetylglucosaminyltransferase subunit Q isoform 2
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class Q
NCBI Official Symbol
PIGQ
NCBI Official Synonym Symbols
GPI1; c407A10.1
NCBI Protein Information
phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
UniProt Protein Name
Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
UniProt Gene Name
PIGQ
UniProt Synonym Gene Names
GPI1; PIG-Q
UniProt Entry Name
PIGQ_HUMAN

NCBI Description

This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2012]

Uniprot Description

PIGQ: Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Belongs to the PIGQ family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; Membrane protein, integral; Membrane protein, multi-pass; EC 2.4.1.198; Transferase

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: endoplasmic reticulum membrane; glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex; integral to membrane

Molecular Function: phosphatidylinositol N-acetylglucosaminyltransferase activity

Biological Process: carbohydrate metabolic process; preassembly of GPI anchor in ER membrane

Research Articles on PIGQ

Similar Products

Product Notes

The PIGQ pigq (Catalog #AAA7026207) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-760aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the PIGQ pigq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VLKAFFPTCC VSTDSGLLVG RWVPEQSSAV VLAVLHFPFI PIQVKQLLAQ VRQASQVGVA VLGTWCHCRQ EPEESLGRFL ESLGAVFPHE PWLRLCRERG GTFWSCEATH RQAPTAPGAP GEDQVMLIFY DQRQVLLSQL HLPTVLPDRQ AGATTASTGG LAAVFDTVAR SEVLFRSDRF DEGPVRLSHW QSEGVEASIL AELARRASGP ICLLLASLLS LVSAVSACRV FKLWPLSFLG SKLSTCEQLR HRLEHLTLIF STRKAENPAQ LMRKANTVAS VLLDVALGLM LLSWLHGRSR IGHLADALVP VADHVAEELQ HLLQWLMGAP AGLKMNRALD QVLGRFFLYH IHLWISYIHL MSPFVEHILW HVGLSACLGL TVALSLLSDI IALLTFHIYC FYVYGARLYC LKIHGLSSLW RLFRGKKWNV LRQRVDSCSY DLDQLFIGTL LFTILLFLLP TTALYYLVFT LLRLLVVAVQ GLIHLLVDLI NSLPLYSLGL RLCRPYRLAD KPTALQPRGA HLPPPQLWLP PQALLGRPVP QAVPWGAHLP LEAERGQAGL RELLARLAPP HGHSQPSALP GWHQLSWRMS CALWTLLCAP EHGRPCYHTL GLEVIGSEQM WGWPARLAAL HHWHCLPWDP LPTCCGHHGG EHSNPRCPEH CPMPTLCTQV QRVRPPQQPQ VEGWSPWGLP SGSALAVGVE GPCQDEPPSP RHPLAPSAEQ HPASGGLKQS LTPVPSGPGP SLPEPHGVYL RMFPGEVAL. It is sometimes possible for the material contained within the vial of "Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q (PIGQ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.