PIGF1 recombinant protein
PIGF1 protein (His Tag)
Applications
User optimized
Purity
> 95% pure
Synonyms
PIGF1; PIGF1 protein (His Tag); PGF protein; Placenta Growth Factor-1 protein; PIGF-1 protein; PIGF 1; PIGF-1; PIGF protein; PIGF 1 protein; PIGF1 recombinant protein
Host
Human
Purity/Purification
> 95% pure
Form/Format
Lyophilized powder with carier protein (HSA). Reconstitute with 0.1 M Acetic Acid or DI water. Can be diluted further with PBS or buffer of choice.
Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDWSEYPSEVEHMFSPSCVSLLRRCTGCCGDENLHCVPVERANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPI
Applicable Applications for PIGF1 recombinant protein
User optimized
Source
Insect cells
Contaminants
Endotoxin level: <0.1 ng/ug of PIGF-1
Additional Remarks
Specific activity: 1 x 106 units/mg
Protein Type
Binding Protein
Biohazard
For research use only. Use standard laboratory precautions when handling.
Tag/Conjugate
His Tag
Biological Significance
Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues and fused to a C-terminal His-tag (6x His), is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversal. In several reports it was shown not to be a potent mitogen for endotehlial cells and not angiogenic in vivo by using different assays.
Preparation and Storage
Stable at room temperature. Best stored at -20°C to -70°C.
Related Product Information for PIGF1 recombinant protein
Purified recombinant Human PIGF1 protein (His Tag)
Product Categories/Family for PIGF1 recombinant protein
Similar Products
Product Notes
The PIGF1 (Catalog #AAA536567) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PIGF1 can be used in a range of immunoassay formats including, but not limited to, User optimized. Researchers should empirically determine the suitability of the PIGF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LPAVPPQQWA LSAGNGSSEV EVVPFQEVWG RSYCRALERL VDWSEYPSEV EHMFSPSCVS LLRRCTGCCG DENLHCVPVE RANVTMQLLK IRSGDRPSYV ELTFSQHVRC ECRPI. It is sometimes possible for the material contained within the vial of "PIGF1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
