14 kDa phosphohistidine phosphatase Recombinant Protein | PHPT1 recombinant protein

Recombinant Human 14 kDa phosphohistidine phosphatase

Cat. Num. AAA1265121

• Gene Names: PHPT1; PHP14; CGI-202; HSPC141; HEL-S-132P
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 14 kDa phosphohistidine phosphatase; Recombinant Human 14 kDa phosphohistidine phosphatase; Phosphohistidine phosphatase 1; Protein janus-A homolog; PHPT1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-125aa; Full Length
• Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
• Sequence Length: 124

• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PHPT1 recombinant protein

Exhibits phosphohistidine phosphatase activity.

Product Categories/Family for PHPT1 recombinant protein

Cell Biology

References

Identification and characterization of a mammalian 14-kDa phosphohistidine phosphatase.Ek P., Pettersson G., Ek B., Gong F., Li J.-P., Zetterqvist O.Eur. J. Biochem. 269:5016-5023(2002) Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M., Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) Identification of the human crooked neck gene by comparative gene identification.Lai C.-H., Chiu J.-Y., Lin W.-C.Biochim. Biophys. Acta 1517:449-454(2001) Towards a catalog of human genes and proteins sequencing and analysis of 500 novel complete protein coding human cDNAs.Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B., Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.Genome Res. 11:422-435(2001) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 209529723
• NCBI GeneID: 29085
• NCBI Accession #: NP_001129333.1
• NCBI GenBank Nucleotide #: NM_001135861.2
• UniProt Accession #: Q9NRX4; Q9H0Y3; B1AMX0; B1AMX1
• Molecular Weight: 15.8 kDa
• NCBI Official Full Name: 14 kDa phosphohistidine phosphatase isoform 2
• NCBI Official Synonym Full Names: phosphohistidine phosphatase 1
• NCBI Official Symbol: PHPT1
• NCBI Official Synonym Symbols: PHP14; CGI-202; HSPC141; HEL-S-132P
• NCBI Protein Information: 14 kDa phosphohistidine phosphatase
• UniProt Protein Name: 14 kDa phosphohistidine phosphatase
• Protein Family: 14 kDa phosphohistidine phosphatase
• UniProt Gene Name: PHPT1
• UniProt Synonym Gene Names: PHP14
• UniProt Entry Name: PHP14_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

PHPT1: a phosphohistidine phosphatase. Present preferentially in heart and skeletal muscle. Insensitive to inhibition by okadaic acid and EDTA.

Protein type: Motility/polarity/chemotaxis; Cofactor and Vitamin Metabolism - thiamine; Phosphatase; Cofactor and Vitamin Metabolism - riboflavin; Carbohydrate Metabolism - fructose and mannose; EC 3.1.3.-

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: cytosol

Molecular Function: calcium channel inhibitor activity; phosphohistidine phosphatase activity; phosphoprotein phosphatase activity

Biological Process: negative regulation of lyase activity; negative regulation of T cell receptor signaling pathway; protein amino acid dephosphorylation