Phosphotriesterase homology protein (php) Recombinant Protein | php recombinant protein

Recombinant Escherichia coli Phosphotriesterase homology protein (php)

Cat. Num. AAA1130007

• Gene Names: php; ECK3366; JW3342; yhfV
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Phosphotriesterase homology protein (php); Recombinant Escherichia coli Phosphotriesterase homology protein (php); php recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-292, full length protein
• Sequence: MSFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ
• Sequence Length: 292

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16131257
• NCBI GeneID: 947891
• NCBI Accession #: NP_417838.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P45548; Q2M744
• Molecular Weight: 32,915 Da
• NCBI Official Full Name: phosphotriesterase homology protein
• NCBI Official Symbol: php
• NCBI Official Synonym Symbols: ECK3366; JW3342; yhfV
• NCBI Protein Information: phosphotriesterase homology protein
• UniProt Protein Name: Phosphotriesterase homology protein
• Protein Family: Phosphotriesterase homology protein
• UniProt Gene Name: php
• UniProt Synonym Gene Names: yhfV

NCBI Description

The Php protein is similar to phosphotriesterase from Pseudomonas diminuta, but unlike that enzyme, it does not catalyze the hydrolysis of nonspecific phosphotriesters. [More information is available at EcoCyc: G7731].

Uniprot Description

Its real enzymatic activity is not yet known. It was tested for general esterase, aminopeptidase, sulfatase, phosphatase, carbonic anhydrase, phosphodiesterase, and phosphotriesterase activities with the following substrates: p-nitrophenyl acetate, L-alanine nitroanilide, p-nitrophenyl sulfate, bis(p-nitrophenyl) phosphate, paraoxon, and p-nitrophenyl phosphate. No enzymatic activity was detected with any of these non-specific substrates.