CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) Recombinant Protein | pgsA recombinant protein
Recombinant Mycoplasma pneumoniae CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)
Gene Names
pgsA; A65_orf227
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA); Recombinant Mycoplasma pneumoniae CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA); Recombinant CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA); CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase EC= 2.7.8.5; Phosphatidylglycerophosphate synthase; PGP synthase; pgsA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-227
Sequence
MRSPFPVPMVPLTIKTWQKKLPNWLTIYRIFIAVPTIIFLGLNHLLGSVASFTVLGNVTIHLQVSLFIGGVLFITAVISDYLDGYWARKWRVVSNFGKLWDPLADKVIINGVLIALVAYGYFHFSFLIVIVLRDLVLDGLRFYAQEKQLIIPANQWGKWKTTWQMIAILMSCFVFSFSLKETNSANTKIFYWAIVHLPYYLATAFSLVSFGIYAQQIYKTIKVKVKL
Sequence Length
227
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,050 Da
NCBI Official Full Name
phosphatidylglycerophosphate synthase
NCBI Official Symbol
pgsA
NCBI Official Synonym Symbols
A65_orf227
NCBI Protein Information
phosphatidylglycerophosphate synthase
UniProt Protein Name
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
Protein Family
UniProt Gene Name
pgsA
UniProt Synonym Gene Names
PGP synthase
UniProt Entry Name
PGSA_MYCPN
Uniprot Description
Function: This protein catalyzes the committed step to the synthesis of the acidic phospholipids
By similarity.
Catalytic activity: CDP-diacylglycerol + sn-glycerol 3-phosphate = CMP + 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate.
Pathway: Phospholipid metabolism; phosphatidylglycerol biosynthesis; phosphatidylglycerol from CDP-diacylglycerol: step 1/2.
Subcellular location: Cell membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
Similar Products
Product Notes
The pgsA pgsa (Catalog #AAA1071926) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-227. The amino acid sequence is listed below: MRSPFPVPMV PLTIKTWQKK LPNWLTIYRI FIAVPTIIFL GLNHLLGSVA SFTVLGNVTI HLQVSLFIGG VLFITAVISD YLDGYWARKW RVVSNFGKLW DPLADKVIIN GVLIALVAYG YFHFSFLIVI VLRDLVLDGL RFYAQEKQLI IPANQWGKWK TTWQMIAILM SCFVFSFSLK ETNSANTKIF YWAIVHLPYY LATAFSLVSF GIYAQQIYKT IKVKVKL. It is sometimes possible for the material contained within the vial of "CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
