Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Biofilm PGA synthesis protein PgaD (pgaD) Recombinant Protein | pgaD recombinant protein

Recombinant Escherichia coli Biofilm PGA synthesis protein PgaD (pgaD)

Gene Names
pgaD; ECK1011; hmsS; JW1006; ycdP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Biofilm PGA synthesis protein PgaD (pgaD); Recombinant Escherichia coli Biofilm PGA synthesis protein PgaD (pgaD); Recombinant Biofilm PGA synthesis protein PgaD (pgaD); Biofilm PGA synthesis protein PgaD; pgaD recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-137
Sequence
MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA
Sequence Length
137
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,082 Da
NCBI Official Full Name
required for biofilm adhesin polysaccharide PGA synthesis
NCBI Official Symbol
pgaD
NCBI Official Synonym Symbols
ECK1011; hmsS; JW1006; ycdP
NCBI Protein Information
required for biofilm adhesin polysaccharide PGA synthesis
UniProt Protein Name
Biofilm PGA synthesis protein PgaD
UniProt Gene Name
pgaD
UniProt Synonym Gene Names
ycdP
UniProt Entry Name
PGAD_ECOLI

NCBI Description

PgaD complements a mutation in the homologous Y. pestis hemin storage gene hmsS. [More information is available at EcoGene: EG13862]. The PgaD protein is involved in biofilm formation. [More information is available at EcoCyc: G6528].

Uniprot Description

Function: Required for the synthesis of poly-beta-1,6-N-acetyl-D-glucosamine (PGA), a biofilm adhesin polysaccharide. May assist the glycosyltransferase PgaC in the polymerization of PGA. Ref.4 Ref.6 Ref.7

Subcellular location: Cell inner membrane; Multi-pass membrane protein.

Induction: Levels of this protein are positively controlled by the second messenger c-di-GMP (at protein level) at a post-transcriptional level. Increased levels of c-di-GMP lead to increased levels of PgaD. Ref.7

Disruption phenotype: Cells lacking this gene do not synthesize PGA. Ref.4 Ref.6

Similar Products

Product Notes

The pgaD pgad (Catalog #AAA1096255) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-137. The amino acid sequence is listed below: MNNLIITTRQ SPVRLLVDYV ATTILWTLFA LFIFLFAMDL LTGYYWQSEA RSRLQFYFLL AVANAVVLIV WALYNKLRFQ KQQHHAAYQY TPQEYAESLA IPDELYQQLQ KSHRMSVHFT SQGQIKMVVS EKALVRA. It is sometimes possible for the material contained within the vial of "Biofilm PGA synthesis protein PgaD (pgaD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.