Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 (PFKFB2) Recombinant Protein | PFKFB2 recombinant protein

Recombinant Human 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 (PFKFB2)

Gene Names
PFKFB2; PFK-2/FBPase-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
6-phosphofructo-2-kinase/fructose-2; 6-bisphosphatase 2 (PFKFB2); Recombinant Human 6-phosphofructo-2-kinase/fructose-2; PFKFB2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-505, Full length protein
Sequence
SGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD
Sequence Length
504
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PFKFB2 recombinant protein
This protein is involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate, and a fructose-2,6-biphosphatase activity that catalyzes the degradation of fructose-2,6-bisphosphate. This protein regulates fructose-2,6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2,6-bisphosphate levels in the liver and muscle. This enzyme functions as a homodimer. Two transcript variants encoding two different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,406 Da
NCBI Official Full Name
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 isoform b
NCBI Official Synonym Full Names
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
NCBI Official Symbol
PFKFB2
NCBI Official Synonym Symbols
PFK-2/FBPase-2
NCBI Protein Information
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
UniProt Protein Name
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
UniProt Gene Name
PFKFB2
UniProt Synonym Gene Names
6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2

NCBI Description

The protein encoded by this gene is involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate, and a fructose-2,6-biphosphatase activity that catalyzes the degradation of fructose-2,6-bisphosphate. This protein regulates fructose-2,6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2,6-bisphosphate levels in the liver and muscle. This enzyme functions as a homodimer. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Synthesis and degradation of fructose 2,6-bisphosphate.

Research Articles on PFKFB2

Similar Products

Product Notes

The PFKFB2 pfkfb2 (Catalog #AAA1182084) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-505, Full length protein. The amino acid sequence is listed below: SGASSSEQNN NSYETKTPNL RMSEKKCSWA SYMTNSPTLI VMIGLPARGK TYVSKKLTRY LNWIGVPTKV FNLGVYRREA VKSYKSYDFF RHDNEEAMKI RKQCALVALE DVKAYLTEEN GQIAVFDATN TTRERRDMIL NFAEQNSFKV FFVESVCDDP DVIAANILEV KVSSPDYPER NRENVMEDFL KRIECYKVTY RPLDPDNYDK DLSFIKVINV GQRFLVNRVQ DYIQSKIVYY LMNIHVQPRT IYLCRHGESE FNLLGKIGGD SGLSVRGKQF AQALRKFLEE QEITDLKVWT SQLKRTIQTA ESLGVPYEQW KILNEIDAGV CEEMTYAEIE KRYPEEFALR DQEKYLYRYP GGESYQDLVQ RLEPVIMELE RQGNVLVISH QAVMRCLLAY FLDKGADELP YLRCPLHTIF KLTPVAYGCK VETIKLNVEA VNTHRDKPTN NFPKNQTPVR MRRNSFTPLS SSNTIRRPRN YSVGSRPLKP LSPLRAQDMQ EGAD. It is sometimes possible for the material contained within the vial of "6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 (PFKFB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.