Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Prefoldin subunit 5 Recombinant Protein | PFDN5 recombinant protein

Recombinant human Prefoldin subunit 5

Gene Names
PFDN5; MM1; MM-1; PFD5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prefoldin subunit 5; Recombinant human Prefoldin subunit 5; Recombinant human Prefoldin subunit 5 protein; PFDN5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for PFDN5 recombinant protein
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Ref.7
References
[1] "MM-1, a novel c-Myc-associating protein that represses transcriptional activity of c-Myc."

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 KD
NCBI Official Full Name
Homo sapiens prefoldin subunit 5 (PFDN5), transcript variant 1, mRNA
NCBI Official Synonym Full Names
prefoldin subunit 5
NCBI Official Symbol
PFDN5
NCBI Official Synonym Symbols
MM1; MM-1; PFD5
NCBI Protein Information
prefoldin subunit 5; myc modulator-1; c-myc binding protein
UniProt Protein Name
Prefoldin subunit 5
Protein Family
UniProt Gene Name
PFDN5
UniProt Synonym Gene Names
MM1; PFD5
UniProt Entry Name
PFD5_HUMAN

NCBI Description

This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC. Ref.9

Subunit structure: Heterohexamer of two PFD-alpha type and four PFD-beta type subunits. Binds to MYC; interacts with its N-terminal domain.

Subcellular location: Isoform 1: Nucleus Ref.3. Isoform 2: Cytoplasm Ref.3. Isoform 3: Nucleus Ref.3.

Tissue specificity: Highly expressed in pancreas and skeletal muscle and moderately in other tissues.

Sequence similarities: Belongs to the prefoldin subunit alpha family.

Sequence caution: The sequence BAA14006.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on PFDN5

Similar Products

Product Notes

The PFDN5 pfdn5 (Catalog #AAA717191) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AQSINITELN LPQLEMLKNQ LDQEVEFLST SIAQLKVVQT KYVEAKDCLN VLNKSNEGKE LLVPLTSSMY VPGKLHDVEH VLIDVGTGYY VEKTAEDAKD FFKRKIDFLT KQMEKIQPAL QEKHAMKQAV MEMMSQKIQQ LTALGAAQAT AKA. It is sometimes possible for the material contained within the vial of "Prefoldin subunit 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.