Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) Recombinant Protein | Alvin_0068 recombinant protein

Recombinant Allochromatium vinosum Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA); Recombinant Allochromatium vinosum Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA); Alvin_0068 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-207
Sequence
MLASAGGYWPMSAQGVNKMRRRVLVAATSVVGAVGAGYALVPFVASMNPSARARAAGAPVEADISKLEPGALLRVKWRGKPVWVVHRSPEMLAALSSNDPKLVDPTSEVPQQPDYCKNPTRSIKPEYLVAIGICTHLGCSPTYRPEFGPDDLGSDWKGGFHCPCHGSRFDLAARVFKNVPAPTNLVIPKHVYLNDTTILIGEDRGSA
Sequence Length
189
Species
Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / D) (Chromatium vinosum)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for Alvin_0068 recombinant protein
petA

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,190 Da
NCBI Official Full Name
ubiquinol-cytochrome c reductase, iron-sulfur subunit
NCBI Official Symbol
Alvin_0068
NCBI Protein Information
ubiquinol-cytochrome c reductase, iron-sulfur subunit
UniProt Protein Name
Ubiquinol-cytochrome c reductase iron-sulfur subunit
UniProt Gene Name
petA
UniProt Synonym Gene Names
RISP
UniProt Entry Name
UCRI_ALLVD

Uniprot Description

Function: Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Catalytic activity: QH2 + 2 ferricytochrome c = Q + 2 ferrocytochrome c + 2 H+.

Cofactor: Binds 1 2Fe-2S cluster per subunit

By similarity.

Subunit structure: The main subunits of complex b-c1 are: cytochrome b, cytochrome c1 and the Rieske protein.

Subcellular location: Cell membrane; Single-pass membrane protein

Potential.

Miscellaneous: The Rieske protein is a high potential 2Fe-2S protein.

Sequence similarities: Contains 1 Rieske domain.

Sequence caution: The sequence ADC61040.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Similar Products

Product Notes

The Alvin_0068 peta (Catalog #AAA1055867) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-207. The amino acid sequence is listed below: MLASAGGYWP MSAQGVNKMR RRVLVAATSV VGAVGAGYAL VPFVASMNPS ARARAAGAPV EADISKLEPG ALLRVKWRGK PVWVVHRSPE MLAALSSNDP KLVDPTSEVP QQPDYCKNPT RSIKPEYLVA IGICTHLGCS PTYRPEFGPD DLGSDWKGGF HCPCHGSRFD LAARVFKNVP APTNLVIPKH VYLNDTTILI GEDRGSA. It is sometimes possible for the material contained within the vial of "Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.