Podoplanin, soluble Recombinant Protein | PDPN recombinant protein

Human Podoplanin, soluble

Cat. Num. AAA691538

• Gene Names: PDPN; T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; T1A-2; AGGRUS; HT1A-1; PA2.26
• Reactivity: Human
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: Podoplanin; soluble; Human Podoplanin; Recombinant Human soluble Podoplanin; GP36; Glycoprotein 36; Aggrus; T1-alpha; PDPN recombinant protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: GSSHHHHHHSSGLVPRGSHMEGASTGQPEDDTETTGLEGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLST
• Sequence Length: 127

• N Terminal Sequence: GSHMEGASTGQ
• Buffer: PBS
• Length (aa): 127
• Stabilizer: None
• Reconstitution: We recommend a quick spin followed by reconstitution in water to a concentration of 0.1 - 1.0 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.
• Preparation and Storage: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20 degree C. Reconstituted sPodoplanin should be stored in working aliquots at -20 degree C.

Testing Data

(SDS-PAGE analysis of recombinant human soluble Podoplanin. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Silver stain.)

Related Product Information for PDPN recombinant protein

Podoplanin, also known as glycoprotein 36 (gp36), PA2.26 antigen, T1-alpha (T1A), and aggrus, is a 36 kDa type I transmembrane sialoglycoprotein and member of the Podoplanin family. Podoplanin has three potential splice variants, the longest of which is represented by a 238 amino acid precursor (NP_006465). It contains an undefined signal sequence, a 22 aa transmembrane segment (aa 207-228) and a short cytoplasmic tail (aa 229-238). The ECD contains abundant Ser/Thr residues that could serve as potential O-linked glycosylation sites. The cytoplasmic tail contains putative sites for protein kinase C phosphorylation. There are two potential alternate start sites at Met 77 (Swiss Prot #: Q86YL7) and Met 119 (EAW51692) that generate short forms. The 162 aa short form Podoplanin precursor shares 47% aa identity with mouse Podoplanin. Podoplanin is expressed on glomerular epithelial cells (podocytes), type I lung alveolar cells, lymphatic endothelial cells, and numerous tumors, including colorectal tumors, squamous cell carcinomas, testicular seminoma, and brain tumors. One study shows high expression of Podoplanin mRNA in placenta, lung, skeletal muscle, and heart, and weaker levels in brain, kidney, and liver. Podoplanin is the ligand for C-type lectin-like receptor 2 (CLEC-2). Their association is dependent on sialic acid on O-glycans of Podoplanin. Through its association with CLEC-2, Podoplanin induces platelet aggregation and tumor metastasis. Podoplanin is also necessary for lymphatic vessel formation, normal lung cell proliferation and alveolus formation at birth. The recombinant soluble Podoplanin starts with GLST and ends with GLST.

Product Categories/Family for PDPN recombinant protein

Soluble receptors

References

1. Breiteneder-Geleff et al, Am J Pathol 154:385, 1999 2. Kerjaschki et al, Nature Med 12:230, 2006 3. Kriehuber et al, J Exp Med 194:797, 2001 4. Zimmer. et al, Biochem J 341:277, 1999 5. Kato et al, Tumour Biol 26:195, 2005 6. Katsue-Inoue et al, J Biol Chem 282:25993, 2007 7. Kato et al, Oncogene 23:8552, 2004 8. Schacht. et al, Am J Pathol 166:913, 2005 9. Mishima et al, Acta Neuropathol 111:483, 2006

NCBI and Uniprot Product Information

• NCBI GI #: 54792060
• NCBI GeneID: 10630
• NCBI Accession #: NP_001006625.1
• NCBI GenBank Nucleotide #: NM_001006624.1
• UniProt Accession #: Q86YL7; O60836; O95128; Q7L375; Q8NBQ8; Q8NBR3; A9Z1Y2; B2R6J8; E9PB68; F6QWX5
• Molecular Weight: 13,1 kDa
• NCBI Official Full Name: podoplanin isoform c
• NCBI Official Synonym Full Names: podoplanin
• NCBI Official Symbol: PDPN
• NCBI Official Synonym Symbols: T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; T1A-2; AGGRUS; HT1A-1; PA2.26
• NCBI Protein Information: podoplanin; T1-alpha; hT1alpha-1; hT1alpha-2; PA2.26 antigen; glycoprotein 36; glycoprotein, 36-KD; lung type I cell membrane associated glycoprotein; lung type-I cell membrane-associated glycoprotein (T1A-2)
• UniProt Protein Name: Podoplanin
• Protein Family: Podoplanin
• UniProt Gene Name: PDPN
• UniProt Synonym Gene Names: GP36; Gp36; T1A
• UniProt Entry Name: PDPN_HUMAN

NCBI Description

This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Required for normal lung cell proliferation and alveolus formation at birth. Induces platelet aggregation. Does not have any effect on folic acid or amino acid transport. Does not function as a water channel or as a regulator of aquaporin-type water channels. Ref.1 Ref.6 Ref.10 Ref.11 UniProtKB Q62011

Subcellular location: Membrane; Single-pass type I membrane protein

By similarity. Cell projection › filopodium membrane; Single-pass type I membrane protein

By similarity. Cell projection › lamellipodium membrane; Single-pass type I membrane protein

By similarity. Cell projection › microvillus membrane; Single-pass type I membrane protein

By similarity. Cell projection › ruffle membrane; Single-pass type I membrane protein

By similarity. Note: Localized to actin-rich microvilli and plasma membrane projections such as filopodia, lamellipodia and ruffles

By similarity. UniProtKB Q64294 UniProtKB Q62011

Tissue specificity: Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in colorectal tumors and expressed in 25% of early oral squamous cell carcinomas. Ref.2 Ref.6 Ref.10

Post-translational modification: Extensively O-glycosylated. Contains sialic acid residues. O-glycosylation is necessary for platelet aggregation activity. Ref.2 Ref.6 Ref.11The N-terminus is blocked

By similarity. UniProtKB Q64294

Sequence similarities: Belongs to the podoplanin family.

Sequence caution: The sequence AAM73655.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAO22143.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence BAC11550.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence BAC11557.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence BAG35495.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.