[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial (Pdk1) Recombinant Protein | Pdk1 recombinant protein
Recombinant Rat [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial (Pdk1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; mitochondrial (Pdk1); Recombinant Rat [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; Pdk1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-434, full length protein
Sequence
ASDSASGSGPASESGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKTIYEFTDTVIRIRNRHNDVIPTMAQGVTEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVIKDGYENARRLCDLYYVNSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVYPPIQVHVTLGEEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTESIERLPVYNKAAWKHYRTNHEADDWCVPSREPKDMTTFRSS
Sequence Length
408
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pdk1 recombinant protein
Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation
dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation.
dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
49,081 Da
NCBI Official Full Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
NCBI Official Synonym Full Names
pyruvate dehydrogenase kinase 1
NCBI Official Symbol
Pdk1
NCBI Protein Information
pyruvate dehydrogenase kinase, isozyme 1
UniProt Protein Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
Protein Family
UniProt Gene Name
Pdk1
UniProt Synonym Gene Names
Pdh; PDH kinase 1
NCBI Description
catalyzes the phosphorylation and inactivation of the pyruvate dehydrogenase complex [RGD, Feb 2006]
Uniprot Description
Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Plays an important role in cellular responses to hypoxia and is important for cell proliferation under hypoxia. Protects cells against apoptosis in response to hypoxia and oxidative stress.
Research Articles on Pdk1
Similar Products
Product Notes
The Pdk1 pdk1 (Catalog #AAA1434227) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-434, full length protein. The amino acid sequence is listed below: ASDSASGSGP ASESGVPGQV DFYARFSPSP LSMKQFLDFG SVNACEKTSF MFLRQELPVR LANIMKEISL LPDNLLRTPS VQLVQSWYIQ SLQELLDFKD KSAEDAKTIY EFTDTVIRIR NRHNDVIPTM AQGVTEYKES FGVDPVTSQN VQYFLDRFYM SRISIRMLLN QHSLLFGGKG SPSHRKHIGS INPNCDVVEV IKDGYENARR LCDLYYVNSP ELELEELNAK SPGQPIQVVY VPSHLYHMVF ELFKNAMRAT MEHHADKGVY PPIQVHVTLG EEDLTVKMSD RGGGVPLRKI DRLFNYMYST APRPRVETSR AVPLAGFGYG LPISRLYAQY FQGDLKLYSL EGYGTDAVIY IKALSTESIE RLPVYNKAAW KHYRTNHEAD DWCVPSREPK DMTTFRSS. It is sometimes possible for the material contained within the vial of "[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial (Pdk1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
