SDS-PAGE
Programmed cell death protein 2-like (PDCD2L) Recombinant Protein | PDCD2L recombinant protein
Recombinant Human Programmed cell death protein 2-like (PDCD2L)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Programmed cell death protein 2-like (PDCD2L); Recombinant Human Programmed cell death protein 2-like (PDCD2L); Programmed cell death protein 2-like; PDCD2L recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-358aa; Full Length
Sequence
AAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK
Sequence Length
357
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for PDCD2L recombinant protein
Over-expression suppresses AP1, CREB, NFAT, and NF-kB transcriptional activation, and delays cell cycle progression at S phase.
Product Categories/Family for PDCD2L recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66.3 kDa
NCBI Official Full Name
programmed cell death protein 2-like
NCBI Official Synonym Full Names
programmed cell death 2-like
NCBI Official Symbol
PDCD2L
NCBI Protein Information
programmed cell death protein 2-like
UniProt Protein Name
Programmed cell death protein 2-like
Protein Family
UniProt Gene Name
PDCD2L
UniProt Entry Name
PDD2L_HUMAN
Uniprot Description
PDCD2L: Over-expression suppresses AP1, CREB, NFAT, and NF-kB transcriptional activation, and delays cell cycle progression at S phase.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 19q13.11
Cellular Component: membrane; cytoplasm
Biological Process: cell cycle
Research Articles on PDCD2L
Similar Products
Product Notes
The PDCD2L pdcd2l (Catalog #AAA1377091) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-358aa; Full Length. The amino acid sequence is listed below: AAVLKPVLLG LRDAPVHGSP TGPGAWTASK LGGIPDALPT VAAPRPVCQR CGQPLALVVQ VYCPLEGSPF HRLLHVFACA CPGCSTGGAR SWKVFRSQCL QVPEREAQDA QKQGNSLAAE DWCEGADDWG SDTEEGPSPQ FTLDFGNDAS SAKDVDWTAR LQDLRLQDAV LGAAHPVPPG LPLFLPYYIC VADEDDYRDF VNLDHAHSLL RDYQQREGIA MDQLLSQSLP NDGDEKYEKT IIKSGDQTFY KFMKRIAACQ EQILRYSWSG EPLFLTCPTS EVTELPACSQ CGGQRIFEFQ LMPALVSMLK SANLGLSVEF GTILVYTCEK SCWPPNHQTP MEEFCIIQED PDELLFK. It is sometimes possible for the material contained within the vial of "Programmed cell death protein 2-like (PDCD2L), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
