Protein FAM113A (FAM113A) Recombinant Protein | FAM113A recombinant protein
Recombinant Human Protein FAM113A (FAM113A)
Gene Names
PCED1A; FAM113A; C20orf81; bA12M19.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein FAM113A (FAM113A); Recombinant Human Protein FAM113A (FAM113A); FAM113A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-454, Full length protein
Sequence
MVFCLSSEEPRRPLRSDMVHFQASEVQQLLHNKFVVILGDSIQRAVYKDLVLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFCSGSGHHLVRFYFLTRVYSEYLEDVLEELTYGPAPDLVIINSCLWDLSRYGRCSMESYRENLERVFVRMDQVLPDSCLLVWNMAMPLGERITGGFLLPELQPLAGSLRRDVVEGNFYSATLAGDHCFDVLDLHFHFRHAVQHRHRDGVHWDQHAHRHLSHLLLTHVADAWGVELPKRGYPPDPWIEDWAEMNHPFQGSHRQTPDFGEHLALLPPPPSSLPPPMPFPYPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRRMGGPCRQRLRHSERLIHTYKLDRRPPAHSGTWPG
Sequence Length
454
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,441 Da
NCBI Official Full Name
PC-esterase domain-containing protein 1A isoform 2
NCBI Official Synonym Full Names
PC-esterase domain containing 1A
NCBI Official Symbol
PCED1A
NCBI Official Synonym Symbols
FAM113A; C20orf81; bA12M19.1
NCBI Protein Information
PC-esterase domain-containing protein 1A
UniProt Protein Name
PC-esterase domain-containing protein 1A
UniProt Gene Name
PCED1A
UniProt Synonym Gene Names
C20orf81; FAM113A
NCBI Description
The protein encoded by this gene is a member of the GDSL/SGNH superfamily. Members of this family are hydrolytic enzymes with esterase and lipase activity and broad substrate specificity. This protein belongs to the Pmr5-Cas1p-esterase subfamily in that it contains the catalytic triad comprised of serine, aspartate and histidine and lacks two conserved regions (glycine after strand S2 and GxND motif). A pseudogene of this gene has been identified on the long arm of chromosome 2. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Sep 2012]
Similar Products
Product Notes
The FAM113A pced1a (Catalog #AAA1381627) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-454, Full length protein. The amino acid sequence is listed below: MVFCLSSEEP RRPLRSDMVH FQASEVQQLL HNKFVVILGD SIQRAVYKDL VLLLQKDSLL TAAQLKAKGE LSFEQDQLVA GGQLGELHNG TQYREVRQFC SGSGHHLVRF YFLTRVYSEY LEDVLEELTY GPAPDLVIIN SCLWDLSRYG RCSMESYREN LERVFVRMDQ VLPDSCLLVW NMAMPLGERI TGGFLLPELQ PLAGSLRRDV VEGNFYSATL AGDHCFDVLD LHFHFRHAVQ HRHRDGVHWD QHAHRHLSHL LLTHVADAWG VELPKRGYPP DPWIEDWAEM NHPFQGSHRQ TPDFGEHLAL LPPPPSSLPP PMPFPYPLPQ PSPPPLFPPL PQDTPFFPGQ PFPPHEFFNY NPVEDFSMPP HLGCGPGVNF VPGPLPPPIP GPNPHGQHWG PVVHRGMPRY VPNSPYHVRR MGGPCRQRLR HSERLIHTYK LDRRPPAHSG TWPG. It is sometimes possible for the material contained within the vial of "Protein FAM113A (FAM113A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
