Poly [ADP-ribose] polymerase 14 (PARP14) Recombinant Protein | PARP14 recombinant protein

Recombinant Human Poly [ADP-ribose] polymerase 14 (PARP14), partial

Cat. Num. AAA7137025

• Gene Names: PARP14; BAL2; ARTD8; pART8; PARP-14
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Poly [ADP-ribose] polymerase 14 (PARP14); Recombinant Human Poly [ADP-ribose] polymerase 14 (PARP14); partial; ADP-ribosyltransferase diphtheria toxin-like 8B aggressive lymphoma protein 2Poly [ADP-ribose] polymerase 14; PARP14 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process); If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyop
• Sequence Positions: 1605-1801aa, Partial
• Sequence: IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK

• Species: Human
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Function: ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate residues on target proteins (PubMed:16061477, PubMed:27796300, PubMed:18851833, PubMed:25043379). In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation (PubMed:25043379). Has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', thus decreasing STAT1 phosphorylation which negatively regulates pro-inflammatory cytokine production in macrophages in response to IFNG stimulation (PubMed:27796300). However, the role of ADP-ribosylation in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 'Lys-703' (PubMed:29858569). Mono-ADP-ribosylates STAT6; enhancing STAT6-dependent transcription (PubMed:27796300). In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation (PubMed:27796300). Mono-ADP-ribosylates PARP9 (PubMed:27796300).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Product Categories/Family for PARP14 recombinant protein

Epigenetics and Nuclear Signaling

References

"Poly (ADP-ribose) polymerase family member 14 (PARP14) is a novel effector of the JNK2-dependent pro-survival signal in multiple myeloma."Barbarulo A., Iansante V., Chaidos A., Naresh K., Rahemtulla A., Franzoso G., Karadimitris A., Haskard D.O., Papa S., Bubici C.Oncogene 32:4231-4242 (2013)

NCBI and Uniprot Product Information

• NCBI GI #: 154813199
• NCBI GeneID: 54625
• NCBI Accession #: NP_060024.2
• NCBI GenBank Nucleotide #: NM_017554.2
• UniProt Accession #: Q460N5; Q460N4; Q8J027; Q9H9X9; Q9NV60; Q9ULF2; B4E2H0
• Molecular Weight: 89,790 Da
• NCBI Official Full Name: poly
• NCBI Official Synonym Full Names: poly(ADP-ribose) polymerase family member 14
• NCBI Official Symbol: PARP14
• NCBI Official Synonym Symbols: BAL2; ARTD8; pART8; PARP-14
• NCBI Protein Information: poly [ADP-ribose] polymerase 14
• UniProt Protein Name: Poly [ADP-ribose] polymerase 14
• Protein Family: Poly [ADP-ribose] polymerase
• UniProt Gene Name: PARP14
• UniProt Synonym Gene Names: BAL2; KIAA1268; PARP-14; ARTD8

NCBI Description

This gene encodes a member of the poly(ADP-ribose) polymerase (PARP) protein family. The encoded anti-apoptotic protein may regulate aerobic glycolysis and promote survival of cancer cells. Increased expression of this gene has been reported in a variety of tumor types. [provided by RefSeq, Jul 2016]

Uniprot Description

PARP14: Enhances STAT6-dependent transcription. Has ADP-ribosyltransferase activity. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.2.30; Transcription, coactivator/corepressor; Transferase

Chromosomal Location of Human Ortholog: 3q21.1

Cellular Component: cytoplasm; cytosol; membrane; nucleus

Molecular Function: enzyme binding; NAD+ ADP-ribosyltransferase activity; protein binding; RNA binding

Biological Process: innate immune response; negative regulation of gene expression; negative regulation of tyrosine phosphorylation of STAT protein; positive regulation of interleukin-4-mediated signaling pathway; positive regulation of tyrosine phosphorylation of STAT protein; protein ADP-ribosylation; regulation of transcription, DNA-templated; transcription, DNA-dependent