p21-activated protein kinase-interacting protein 1 (Pak1ip1) Recombinant Protein | Pak1ip1 recombinant protein
Recombinant Mouse p21-activated protein kinase-interacting protein 1 (Pak1ip1)
Gene Names
Pak1ip1; PIP1; Gdpd1; AA419825; AI314040; AW556169; 5830431I15Rik; 5930415H02Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
p21-activated protein kinase-interacting protein 1 (Pak1ip1); Recombinant Mouse p21-activated protein kinase-interacting protein 1 (Pak1ip1); Pak1ip1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-382, full length protein
Sequence
MELVAGSYEQVLFGFTVQRGPAKSGHQETWTPVADFTHHSHTASLSVLASNSRYVVSGSKDETIHIYDMKRKVEHGALVHHAGTVTCLKFHGNQHLISGAEDGHICIWDVKRWKCLKTFKAHRGHVTFLSIHPSGKLALSVGTDKTLRTWNLIEGRSAFIKNIKENAHIVEWSPSGGKYIVVVQNKVDVYRLGTASVSGTITNGKRISSVTFLSDSVLAVAGDEEVVRIFDCDSLECLCEFRAHENRVKDMVSFEVPDHHVLVTASNDGFIKMWTLPQDKKVPPSLLCEAKTGARLTCLTVWLDRAANGMASLPPAAEPCPDQPKTIEKESGDTVQEETSEPNSEKSDVSGDSKQPTKGNSPVTAKKRKMATMSEKKRKKKM
Sequence Length
382
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,116 Da
NCBI Official Full Name
p21-activated protein kinase-interacting protein 1
NCBI Official Synonym Full Names
PAK1 interacting protein 1
NCBI Official Symbol
Pak1ip1
NCBI Official Synonym Symbols
PIP1; Gdpd1; AA419825; AI314040; AW556169; 5830431I15Rik; 5930415H02Rik
NCBI Protein Information
p21-activated protein kinase-interacting protein 1
UniProt Protein Name
p21-activated protein kinase-interacting protein 1
Protein Family
UniProt Gene Name
Pak1ip1
Uniprot Description
Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which has been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42. May be involved in ribosomal large subunit assembly.
Research Articles on Pak1ip1
Similar Products
Product Notes
The Pak1ip1 pak1ip1 (Catalog #AAA1465248) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-382, full length protein. The amino acid sequence is listed below: MELVAGSYEQ VLFGFTVQRG PAKSGHQETW TPVADFTHHS HTASLSVLAS NSRYVVSGSK DETIHIYDMK RKVEHGALVH HAGTVTCLKF HGNQHLISGA EDGHICIWDV KRWKCLKTFK AHRGHVTFLS IHPSGKLALS VGTDKTLRTW NLIEGRSAFI KNIKENAHIV EWSPSGGKYI VVVQNKVDVY RLGTASVSGT ITNGKRISSV TFLSDSVLAV AGDEEVVRIF DCDSLECLCE FRAHENRVKD MVSFEVPDHH VLVTASNDGF IKMWTLPQDK KVPPSLLCEA KTGARLTCLT VWLDRAANGM ASLPPAAEPC PDQPKTIEKE SGDTVQEETS EPNSEKSDVS GDSKQPTKGN SPVTAKKRKM ATMSEKKRKK KM. It is sometimes possible for the material contained within the vial of "p21-activated protein kinase-interacting protein 1 (Pak1ip1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
