Platelet-activating factor acetylhydrolase 2, cytoplasmic (Pafah2) Recombinant Protein | Pafah2 recombinant protein
Recombinant Rat Platelet-activating factor acetylhydrolase 2, cytoplasmic (Pafah2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Platelet-activating factor acetylhydrolase 2; cytoplasmic (Pafah2); Recombinant Rat Platelet-activating factor acetylhydrolase 2; Pafah2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-390, Full length protein
Sequence
MGAGQSICFPPISGPHHIGCTDVMEGHSLEGSLFRLFYPCEASETCEQPLWIPRYEYCVGLADYLQYNKRWVGLLFNVGIGSCRLPVSWNGPFKTKESGYPLIILSHGLGGFRVSYSAFCMELASRGFVVAAIEHRDQSAAATYFCKQTSQESSPTESLEEEWIPFRRIKEGEKEFHVRNPQVHQRAKECVRVLQILQDASAGKPVINVFPGGLDLMTLKGSIDMSRVAVMGHSFGGATAILALTQEAQFRCAIALDAWMFPLEHDFYPKARGPVFFINVEKFQTVESVNLMKKICAQHEQSRIVTVLGAVHRSQTDFAFVTGNMIGKLFSSGTRGTLDPYEGQEVMVRAMLAFLQKHLDLKEDYDQWNSFIEGIGPSLIQGAPHYLSSL
Sequence Length
390
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pafah2 recombinant protein
This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,492 Da
NCBI Official Full Name
platelet-activating factor acetylhydrolase 2, cytoplasmic
NCBI Official Synonym Full Names
platelet-activating factor acetylhydrolase 2
NCBI Official Symbol
Pafah2
NCBI Protein Information
platelet-activating factor acetylhydrolase 2, cytoplasmic
UniProt Protein Name
Platelet-activating factor acetylhydrolase 2, cytoplasmic
Protein Family
UniProt Gene Name
Pafah2
UniProt Synonym Gene Names
SD-PLA2Curated
NCBI Description
human homolog catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor resulting in inactivation [RGD, Feb 2006]
Uniprot Description
Has a marked selectivity for phospholipids with short acyl chains at the sn-2 position. May share a common physiologic function with the plasma-type enzyme. Catalyzes transacetylation of the acetyl group from platelet-activating factor (PAF) to lysoplasmalogen and to sphingosine, producing plasmalogen analogs of PAF and N-acetylsphingosine (C2-ceramide) respectively. Acts as a PAF-acetylhydrolase in the absence of lipid acceptor molecules.
Similar Products
Product Notes
The Pafah2 pafah2 (Catalog #AAA962546) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-390, Full length protein. The amino acid sequence is listed below: MGAGQSICFP PISGPHHIGC TDVMEGHSLE GSLFRLFYPC EASETCEQPL WIPRYEYCVG LADYLQYNKR WVGLLFNVGI GSCRLPVSWN GPFKTKESGY PLIILSHGLG GFRVSYSAFC MELASRGFVV AAIEHRDQSA AATYFCKQTS QESSPTESLE EEWIPFRRIK EGEKEFHVRN PQVHQRAKEC VRVLQILQDA SAGKPVINVF PGGLDLMTLK GSIDMSRVAV MGHSFGGATA ILALTQEAQF RCAIALDAWM FPLEHDFYPK ARGPVFFINV EKFQTVESVN LMKKICAQHE QSRIVTVLGA VHRSQTDFAF VTGNMIGKLF SSGTRGTLDP YEGQEVMVRA MLAFLQKHLD LKEDYDQWNS FIEGIGPSLI QGAPHYLSSL. It is sometimes possible for the material contained within the vial of "Platelet-activating factor acetylhydrolase 2, cytoplasmic (Pafah2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
