Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Prolyl 4-hydroxylase subunit alpha-2 (P4ha2) Recombinant Protein | P4ha2 recombinant protein

Recombinant Mouse Prolyl 4-hydroxylase subunit alpha-2 (P4ha2)

Gene Names
P4ha2; P4hl; C76437; AA407196
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prolyl 4-hydroxylase subunit alpha-2 (P4ha2); Recombinant Mouse Prolyl 4-hydroxylase subunit alpha-2 (P4ha2); P4ha2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-537, Full length protein
Sequence
EFFTSIGHMTDLIYAEKDLVQSLKEYILVEEAKLAKIKSWASKMEALTSRSAADPEGYLAHPVNAYKLVKRLNTDWPALGDLVLQDASAGFVANLSVQRQFFPTDEDESGAARALMRLQDTYKLDPDTISRGELPGTKYQAMLSVDDCFGLGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATVTKSLVLDYLSYAVFQLGDLHRAVELTRRLLSLDPSHERAGGNLRYFERLLEEERGKSLSNQTDAGLATQENLYERPTDYLPERDVYESLCRGEGVKLTPRRQKKLFCRYHHGNRVPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGMGGQYEPHFDFSRSDDEDAFKRLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGTTEVD
Sequence Length
514
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for P4ha2 recombinant protein
This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,812 Da
NCBI Official Full Name
prolyl 4-hydroxylase subunit alpha-2 isoform 1
NCBI Official Synonym Full Names
procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha II polypeptide
NCBI Official Symbol
P4ha2
NCBI Official Synonym Symbols
P4hl; C76437; AA407196
NCBI Protein Information
prolyl 4-hydroxylase subunit alpha-2
UniProt Protein Name
Prolyl 4-hydroxylase subunit alpha-2
Protein Family
UniProt Gene Name
P4ha2
UniProt Synonym Gene Names
4-PH alpha-2

Uniprot Description

Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.

Research Articles on P4ha2

Similar Products

Product Notes

The P4ha2 p4ha2 (Catalog #AAA1337608) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-537, Full length protein. The amino acid sequence is listed below: EFFTSIGHMT DLIYAEKDLV QSLKEYILVE EAKLAKIKSW ASKMEALTSR SAADPEGYLA HPVNAYKLVK RLNTDWPALG DLVLQDASAG FVANLSVQRQ FFPTDEDESG AARALMRLQD TYKLDPDTIS RGELPGTKYQ AMLSVDDCFG LGRSAYNEGD YYHTVLWMEQ VLKQLDAGEE ATVTKSLVLD YLSYAVFQLG DLHRAVELTR RLLSLDPSHE RAGGNLRYFE RLLEEERGKS LSNQTDAGLA TQENLYERPT DYLPERDVYE SLCRGEGVKL TPRRQKKLFC RYHHGNRVPQ LLIAPFKEED EWDSPHIVRY YDVMSDEEIE RIKEIAKPKL ARATVRDPKT GVLTVASYRV SKSSWLEEDD DPVVARVNRR MQHITGLTVK TAELLQVANY GMGGQYEPHF DFSRSDDEDA FKRLGTGNRV ATFLNYMSDV EAGGATVFPD LGAAIWPKKG TAVFWYNLLR SGEGDYRTRH AACPVLVGCK WVSNKWFHER GQEFLRPCGT TEVD. It is sometimes possible for the material contained within the vial of "Prolyl 4-hydroxylase subunit alpha-2 (P4ha2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.