P2Y purinoceptor 12 (P2RY12) Recombinant Protein | P2RY12 recombinant protein

Recombinant Human P2Y purinoceptor 12 (P2RY12)

Cat. Num. AAA7025273

• Gene Names: P2RY12; HORK3; P2Y12; ADPG-R; BDPLT8; SP1999; P2T(AC); P2Y(AC); P2Y(12)R; P2Y(ADP); P2Y(cyc)
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: P2Y purinoceptor 12 (P2RY12); Recombinant Human P2Y purinoceptor 12 (P2RY12); P2RY12 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-342. Full Length
• Sequence: MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for P2RY12 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 12232483
• NCBI GeneID: 64805
• NCBI Accession #: NP_073625.1
• NCBI GenBank Nucleotide #: NM_022788.4
• UniProt Accession #: Q9H244; Q546J7; D3DNJ5
• Molecular Weight: 42.2 kDa
• NCBI Official Full Name: P2Y purinoceptor 12
• NCBI Official Synonym Full Names: purinergic receptor P2Y12
• NCBI Official Symbol: P2RY12
• NCBI Official Synonym Symbols: HORK3; P2Y12; ADPG-R; BDPLT8; SP1999; P2T(AC); P2Y(AC); P2Y(12)R; P2Y(ADP); P2Y(cyc)
• NCBI Protein Information: P2Y purinoceptor 12
• UniProt Protein Name: P2Y purinoceptor 12
• Protein Family: P2Y purinoceptor
• UniProt Gene Name: P2RY12
• UniProt Synonym Gene Names: HORK3; P2Y12; ADPG-R; P2Y(ADP)
• UniProt Entry Name: P2Y12_HUMAN

NCBI Description

The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelet aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Mutations in this gene are implicated in bleeding disorder, platelet type 8 (BDPLT8). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

P2Y12: Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Involved in platelets aggregation. Defects in P2RY12 are the cause of bleeding disorder platelet-type 8 (BDPLT8). A condition characterized by mild to moderate mucocutaneous bleeding, and excessive bleeding after surgery or trauma. The defect is due to severe impairment of platelet response to ADP resulting in defective platelet aggregation. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral; Mitochondrial; Receptor, GPCR

Chromosomal Location of Human Ortholog: 3q25.1

Cellular Component: basal plasma membrane; caveola; cell surface; external side of plasma membrane; integral to plasma membrane; intrinsic to membrane; mitochondrion; plasma membrane

Molecular Function: adenosine receptor activity, G-protein coupled; guanyl-nucleotide exchange factor activity; platelet ADP receptor activity

Biological Process: adenosine receptor signaling pathway; G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase inhibiting pathway; glial cell migration; hemostasis; negative regulation of cell differentiation; positive regulation of GTPase activity; positive regulation of ion transport; protein kinase B signaling cascade; regulation of calcium ion transport; substrate-bound cell migration, cell extension

Disease: Bleeding Disorder, Platelet-type, 8