Genome polyprotein Recombinant Protein | P2A recombinant protein

Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial, Biotinylated

Cat. Num. AAA7137014

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Genome polyprotein; Recombinant Human rhinovirus A serotype 89 Genome polyprotein; partial; Biotinylated; 3D polymeraseProtein 3D; P2A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process); If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyop
• Sequence Positions: 575-866aa, Partial
• Sequence: NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV

• Species: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)
• Tag: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
• Function: Capsid protein VP1:Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3 (By similarity). The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome (By similarity). Capsid protein VP1 mainly forms the vertices of the capsid (By similarity). Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells (By similarity). This attachment induces virion internalization (By similarity). Tyrosine kinases are probably involved in the entry process (By similarity). After binding to its receptor, the capsid undergoes conformational changes (By similarity). Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized (By similarity). Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm (By similarity).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Product Categories/Family for P2A recombinant protein

Microbiology

References

"Evolutionary relationships within the human rhinovirus genus: comparison of serotypes 89, 2, and 14."Duechler M., Skern T., Sommergruber W., Neubauer C., Gruendler P., Fogy I., Blaas D., Kuechler E.Proc. Natl. Acad. Sci. U.S.A. 84:2605-2609 (1987)

NCBI and Uniprot Product Information

• NCBI GI #: 130488
• UniProt Accession #: P07210; Q82096; Q82097; Q82098; Q82099; Q82100; Q82101; Q82102; Q82103; Q82104; Q82105
• Molecular Weight: 34.6 kDa
• NCBI Official Full Name: Genome polyprotein
• UniProt Protein Name: Genome polyprotein
• Protein Family: Genome polyprotein
• UniProt Gene Name: P2A
• UniProt Synonym Gene Names: P2B; P2C; P3A; VPg; P3B; P3C; RdRp; 3Dpol; 3D
• UniProt Entry Name: POLG_HRV8A

Uniprot Description

Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Capsid protein VP1 mainly forms the vertices of the capsid. Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells. This attachment induces virion internalization. Tyrosine kinases are probably involved in the entry process. After binding to its receptor, the capsid undergoes conformational changes. Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized. Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm. After genome has been released, the channel shrinks ().