Genome polyprotein Recombinant Protein | PVgp1 recombinant protein

Recombinant Poliovirus type 1 Genome polyprotein

Cat. Num. AAA1029516

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Genome polyprotein; Recombinant Poliovirus type 1 Genome polyprotein; PVgp1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-341, Full length protein
• Sequence: GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLNSPNIEACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVDQPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRNITLPRLQ
• Sequence Length: 340

• Species: Poliovirus type 1 (strain Mahoney)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 9627037
• NCBI GeneID: 919920
• NCBI Accession #: NP_041277.1
• NCBI GenBank Nucleotide #: NC_002058.3
• UniProt Accession #: P03300; P03299; Q84879; Q84880; Q89679; CAA24461
• Molecular Weight: 246,540 Da
• NCBI Official Full Name: genome polyprotein
• NCBI Official Symbol: PVgp1
• NCBI Protein Information: genome polyprotein; precursor polypeptide P1; capsid protein VP0; precursor polypeptide P2; protein 2BC; precursor polypeptide P3; precursor protein 3BCD; capsid protein VP4; capsid protein VP2; capsid protein VP3; capsid protein VP1; protein 2C; protein 3A; viral protein genome-linked; protease 3C; protease 2A; RNA-directed RNA polymerase; protein 3AB; protein 3CD
• UniProt Protein Name: Genome polyprotein
• Protein Family: Genome polyprotein
• UniProt Gene Name: P2A
• UniProt Synonym Gene Names: P2B; P2C; P3A; VPg; P3B; P3C; RdRp; 3Dpol; 3D

Uniprot Description

Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Capsid protein VP1 mainly forms the vertices of the capsid. Capsid protein VP1 interacts with host cell receptor PVR to provide virion attachment to target host epithelial cells. This attachment induces virion internalization predominantly through clathrin- and caveolin-independent endocytosis in Hela cells and through caveolin-mediated endocytosis in brain microvascular endothelial cells. Tyrosine kinases are probably involved in the entry process. Virus binding to PVR induces increased junctional permeability and rearrangement of junctional proteins. Modulation of endothelial tight junctions, as well as cytolytic infection of endothelial cells themselves, may result in loss of endothelial integrity which may help the virus to reach the CNS. After binding to its receptor, the capsid undergoes conformational changes. Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized. Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm. After genome has been released, the channel shrinks.Capsid protein VP2: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome.Capsid protein VP3: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome.Capsid protein VP4: Lies on the inner surface of the capsid shell. After binding to the host receptor, the capsid undergoes conformational changes. Capsid protein VP4 is released, Capsid protein VP1 N-terminus is externalized, and together, they shape a pore in the host membrane through which the viral genome is translocated into the host cell cytoplasm. After genome has been released, the channel shrinks ().