Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Genome polyprotein Recombinant Protein | HCV6_gp1 recombinant protein

Recombinant Hepatitis C virus genotype 6b Genome polyprotein, partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Genome polyprotein; Recombinant Hepatitis C virus genotype 6b Genome polyprotein; partial; HCV6_gp1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2429-3019
Sequence
SMSYTWTGALITPCAAEEEKLPINPLSNSLIRHHNMVYSTTSRSAGLRQKKVTFDRLQVVDQHYQDVLKEIKLRASTVHARLLSTEEACSLTPPHSARSRYGYGARDVRSHTSKAVKHIDSVWEDLLEDNATPIPTTIMAKNEVFCVDPSKGGRKPARLIVYPDLSVRVCEKMALYDVTQKLPKTVMGSAYGFQYSPSQRVEYLLKMWRSKKTPMGFSYDTRCFDSTVTERDIRTEEDIYQSCQLDPTARKAISSLTERLYCGGPMFNSKGESCGYRRCRASGVLTTSLGNTLTCYLKAQAACRAANIKNFDMLVCGDDLVVICESAGVQEDVVALRAFTDAMIRYSAPPGDAPQPTYDLELITSCSSNVSVAHDGTGQRYYYLTRDCTTPLARAAWETARHTPVNSWLGNIIMYAPTIWVRMVLMTHFFSILQCQEQLEAALNFDMYGVTYSVTPLDLPAIIQRLHGMAAFSLHGYSPTELNRVGASLRKLGAPPLRAWRHRARAVRAKLIAQGGKAAICGKYLFNWAVKTKLKLTPLAAASQLDLSGWFVAGYDGGDIYHSVSRARPRLLLLGLLLLTVGVGIFLLPAR
Sequence Length
3019
Species
Hepatitis C virus genotype 6b (isolate Th580) (HCV)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
328,235 Da
NCBI Official Full Name
polyprotein
NCBI Official Symbol
HCV6_gp1
NCBI Protein Information
polyprotein; protein F; core protein; E1 protein; E2 protein; p7 protein; NS2 protein; NS3 protease/helicase; NS4A protein; NS4B protein; NS5A protein; NS5B RNA-dependent RNA polymerase
UniProt Protein Name
Genome polyprotein
Protein Family
UniProt Gene Name
p23
UniProt Synonym Gene Names
NS4A; NS4B; NS5A

Uniprot Description

Core protein packages viral RNA to form a viral nucleocapsid, and promotes virion budding. Modulates viral translation initiation by interacting with HCV IRES and 40S ribosomal subunit. Also regulates many host cellular functions such as signaling pathways and apoptosis. Prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways and by inducing human STAT1 degradation. Thought to play a role in virus-mediated cell transformation leading to hepatocellular carcinomas. Interacts with, and activates STAT3 leading to cellular transformation. May repress the promoter of p53, and sequester CREB3 and SP110 isoform 3/Sp110b in the cytoplasm. Also represses cell cycle negative regulating factor CDKN1A, thereby interrupting an important check point of normal cell cycle regulation. Targets transcription factors involved in the regulation of inflammatory responses and in the immune response: suppresses NK-kappaB activation, and activates AP-1. Could mediate apoptotic pathways through association with TNF-type receptors TNFRSF1A and LTBR, although its effect on death receptor-induced apoptosis remains controversial. Enhances TRAIL mediated apoptosis, suggesting that it might play a role in immune-mediated liver cell injury. Seric core protein is able to bind C1QR1 at the T-cell surface, resulting in down-regulation of T-lymphocytes proliferation. May transactivate human MYC, Rous sarcoma virus LTR, and SV40 promoters. May suppress the human FOS and HIV-1 LTR activity. Alters lipid metabolism by interacting with hepatocellular proteins involved in lipid accumulation and storage. Core protein induces up-regulation of FAS promoter activity, and thereby probably contributes to the increased triglyceride accumulation in hepatocytes (steatosis) ().

Similar Products

Product Notes

The HCV6_gp1 p23 (Catalog #AAA1161053) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2429-3019. The amino acid sequence is listed below: SMSYTWTGAL ITPCAAEEEK LPINPLSNSL IRHHNMVYST TSRSAGLRQK KVTFDRLQVV DQHYQDVLKE IKLRASTVHA RLLSTEEACS LTPPHSARSR YGYGARDVRS HTSKAVKHID SVWEDLLEDN ATPIPTTIMA KNEVFCVDPS KGGRKPARLI VYPDLSVRVC EKMALYDVTQ KLPKTVMGSA YGFQYSPSQR VEYLLKMWRS KKTPMGFSYD TRCFDSTVTE RDIRTEEDIY QSCQLDPTAR KAISSLTERL YCGGPMFNSK GESCGYRRCR ASGVLTTSLG NTLTCYLKAQ AACRAANIKN FDMLVCGDDL VVICESAGVQ EDVVALRAFT DAMIRYSAPP GDAPQPTYDL ELITSCSSNV SVAHDGTGQR YYYLTRDCTT PLARAAWETA RHTPVNSWLG NIIMYAPTIW VRMVLMTHFF SILQCQEQLE AALNFDMYGV TYSVTPLDLP AIIQRLHGMA AFSLHGYSPT ELNRVGASLR KLGAPPLRAW RHRARAVRAK LIAQGGKAAI CGKYLFNWAV KTKLKLTPLA AASQLDLSGW FVAGYDGGDI YHSVSRARPR LLLLGLLLLT VGVGIFLLPA R. It is sometimes possible for the material contained within the vial of "Genome polyprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.