Ovotransferrin Recombinant Protein | TF recombinant protein
Recombinant Chicken Ovotransferrin, partial
Gene Names
TF; LTF; TFEW; conalbumin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ovotransferrin; Recombinant Chicken Ovotransferrin; partial; TF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-355aa; Partial
Sequence
APPKSVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAISLDGGQAFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLGRSAGWNIPIGTLLHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKTKCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYKTCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLFKDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMRKDQL
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,777 Da
NCBI Official Full Name
ovotransferrin
NCBI Official Synonym Full Names
transferrin (ovotransferrin)
NCBI Official Symbol
TF
NCBI Official Synonym Symbols
LTF; TFEW; conalbumin
NCBI Protein Information
ovotransferrin
UniProt Protein Name
Ovotransferrin
Protein Family
Uniprot Description
Transferrins are iron binding transport proteins which can bind two Fe3+ ions in association with the binding of an anion, usually bicarbonate. Responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. There are two forms of hen transferrin, ovotransferrin, found in the ovoducts and, serum transferrin, secreted by the liver. Serum transferrin may also have a role in stimulating cell proliferation and is regulated by iron levels. Ovotransferrin has a bacteriostatic function and, is not controlled by iron levels.
Research Articles on TF
Similar Products
Product Notes
The TF (Catalog #AAA1015943) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-355aa; Partial. The amino acid sequence is listed below: APPKSVIRWC TISSPEEKKC NNLRDLTQQE RISLTCVQKA TYLDCIKAIA NNEADAISLD GGQAFEAGLA PYKLKPIAAE VYEHTEGSTT SYYAVAVVKK GTEFTVNDLQ GKTSCHTGLG RSAGWNIPIG TLLHRGAIEW EGIESGSVEQ AVAKFFSASC VPGATIEQKL CRQCKGDPKT KCARNAPYSG YSGAFHCLKD GKGDVAFVKH TTVNENAPDQ KDEYELLCLD GSRQPVDNYK TCNWARVAAH AVVARDDNKV EDIWSFLSKA QSDFGVDTKS DFHLFGPPGK KDPVLKDLLF KDSAIMLKRV PSLMDSQLYL GFEYYSAIQS MRKDQL . It is sometimes possible for the material contained within the vial of "Ovotransferrin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
