Probable polyprenol reductase 2 Recombinant Protein | LOC4343281 recombinant protein
Recombinant Oryza sativa subsp. japonica Probable polyprenol reductase 2 (Os07g0493400, LOC_Os07g31140)
Gene Names
LOC4343281; OsJ_24314
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable polyprenol reductase 2; Recombinant Oryza sativa subsp. japonica Probable polyprenol reductase 2 (Os07g0493400; LOC_Os07g31140); LOC4343281 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-353aa; full length protein
Sequence
MESEGWPALQPLLCFAWIAATLPIIAAALPIPTAVGGHLLRRLLSAFSSRGKTVRPSPAS SSGSSSSKAKFTVPQKYFMHFYVVGVLATTILLLAIWFYAYMKLTPLLLESSSYSTIFSH LVGSNSFSFGRVRSRTMGHKYRVWRTVFALLLMEVQVLRRLYETEHVFHYSPARMHIVGY LTGLFYYVAAPLSLASSCIPEAAEYFQGQVPEFVVKGRARMPDLVIDSSSLLQPLLKLGW TQWIGAVIFIWGSLHQIRCHAILGSLREHKDYDEYVIPCGDCFNRVSCPHYLAELVIYFG MLVASGAEDIPVWFLFIFVITNLSFAAVETYNWYLQKFEDYPRSRYAIIPFVC
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Oryza sativa subsp. japonica (Rice)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for LOC4343281 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,935 Da
NCBI Official Full Name
polyprenol reductase 2
NCBI Official Symbol
LOC4343281
NCBI Official Synonym Symbols
OsJ_24314
NCBI Protein Information
polyprenol reductase 2; LOC_Os07g31140; Os07g0493400; P0038F10.126; putative 3-oxo-5-alpha-steroid 4-dehydrogenase
UniProt Protein Name
Polyprenol reductase 2
UniProt Gene Name
Os07g0493400
UniProt Entry Name
POED2_ORYSJ
Uniprot Description
Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism ().
Similar Products
Product Notes
The LOC4343281 os07g0493400 (Catalog #AAA7039078) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-353aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the LOC4343281 os07g0493400 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MESEGWPALQ PLLCFAWIAA TLPIIAAALP IPTAVGGHLL RRLLSAFSSR GKTVRPSPAS SSGSSSSKAK FTVPQKYFMH FYVVGVLATT ILLLAIWFYA YMKLTPLLLE SSSYSTIFSH LVGSNSFSFG RVRSRTMGHK YRVWRTVFAL LLMEVQVLRR LYETEHVFHY SPARMHIVGY LTGLFYYVAA PLSLASSCIP EAAEYFQGQV PEFVVKGRAR MPDLVIDSSS LLQPLLKLGW TQWIGAVIFI WGSLHQIRCH AILGSLREHK DYDEYVIPCG DCFNRVSCPH YLAELVIYFG MLVASGAEDI PVWFLFIFVI TNLSFAAVET YNWYLQKFED YPRSRYAIIP FVC. It is sometimes possible for the material contained within the vial of "Probable polyprenol reductase 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
