Virion-associated protein (ORF III) Recombinant Protein | ORF III recombinant protein
Recombinant Figwort mosaic virus Virion-associated protein (ORF III)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Virion-associated protein (ORF III); Recombinant Figwort mosaic virus Virion-associated protein (ORF III); ORF III recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-115, Full length protein
Sequence
MAATLSEIRELIQSLTKTANEIKAMLERNSAGKPTGIEEAAAKIIKDIGDKIDQCECTKKIEEMLDQKQNADTQIVPTKQESSGLVKYSYPNWNVGNEELGSSGNPNAVKWPPRK
Sequence Length
115
Species
Figwort mosaic virus (strain DxS) (FMV)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,675 Da
NCBI Official Full Name
unnamed protein product
NCBI Official Symbol
FMVgp3
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Virion-associated protein
UniProt Gene Name
ORF III
UniProt Synonym Gene Names
Vap; P3
Uniprot Description
Plays a role in virus cell-to-cell and plant-to-plant transmission. Interacts with virion icosahedral capsid and movement protein, thereby facilitating virion cell-to-cell transmission through plasmodesmata opened by viral movement protein. Also interacts with aphid transmission factor, attaching the virion to aphid stylet when the animal feeds on an virus infected plant. Aphid saliva may later detach the virion, inducing release of infectious particles when the animal feeds on a new plant ().
Similar Products
Product Notes
The ORF III orf iii (Catalog #AAA1213579) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-115, Full length protein. The amino acid sequence is listed below: MAATLSEIRE LIQSLTKTAN EIKAMLERNS AGKPTGIEEA AAKIIKDIGD KIDQCECTKK IEEMLDQKQN ADTQIVPTKQ ESSGLVKYSY PNWNVGNEEL GSSGNPNAVK WPPRK. It is sometimes possible for the material contained within the vial of "Virion-associated protein (ORF III), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
