Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative olfactory receptor 4A8 (OR4A8P) Recombinant Protein | OR4A8P recombinant protein

Recombinant Human Putative olfactory receptor 4A8 (OR4A8P)

Gene Names
OR4A8P; OR4A8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative olfactory receptor 4A8 (OR4A8P); Recombinant Human Putative olfactory receptor 4A8 (OR4A8P); Recombinant Putative olfactory receptor 4A8 (OR4A8P); Putative olfactory receptor 4A8; Olfactory receptor OR11-110; OR4A8P recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-315
Sequence
MRQNNNITEFVLLGFSQYPDVQNALFVMFLLIYIVTMVGNLLIVVSIIASPFLGSPVYFFLACLSFIDAVYSTTISPVLIVDLLCDKKTISFPACMGQLFIEHLFGDTDVFLLVVMAYDRYVATCKPLRYLTIMNRQVCILLLVVAVTGGFLHSVFQILVVYSLPFCGPNVIYHFFCNIYPLLDLECTDTYFVGLAVVFNGGAICMVIFTLLLISYGVILNSLKTYSPEGRHKAPFICSSHFIMVILFFVPCIFLYVRPVSNFPIDKFLTVFYSVITPKLNPFIYMLRNSEMRNAIENLLGYQSGKTGFRCSKLN
Sequence Length
315
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
35,621 Da
NCBI Official Full Name
Putative olfactory receptor 4A8
NCBI Official Synonym Full Names
olfactory receptor, family 4, subfamily A, member 8 pseudogene
NCBI Official Symbol
OR4A8P
NCBI Official Synonym Symbols
OR4A8
UniProt Protein Name
Putative olfactory receptor 4A8
UniProt Gene Name
OR4A8P
UniProt Synonym Gene Names
OR4A8
UniProt Entry Name
OR4A8_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Odorant receptor

Potential.

Subcellular location: Cell membrane; Multi-pass membrane protein.

Polymorphism: A stop codon in the gene coding for this protein at position Arg-136 is responsible for functional diversity thus producing a pseudogene. The stop codon is more frequent in African-Americans than in non-Africans.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Caution: Could be the product of a pseudogene.

Similar Products

Product Notes

The OR4A8P or4a8p (Catalog #AAA717947) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-315. The amino acid sequence is listed below: MRQNNNITEF VLLGFSQYPD VQNALFVMFL LIYIVTMVGN LLIVVSIIAS PFLGSPVYFF LACLSFIDAV YSTTISPVLI VDLLCDKKTI SFPACMGQLF IEHLFGDTDV FLLVVMAYDR YVATCKPLRY LTIMNRQVCI LLLVVAVTGG FLHSVFQILV VYSLPFCGPN VIYHFFCNIY PLLDLECTDT YFVGLAVVFN GGAICMVIFT LLLISYGVIL NSLKTYSPEG RHKAPFICSS HFIMVILFFV PCIFLYVRPV SNFPIDKFLT VFYSVITPKL NPFIYMLRNS EMRNAIENLL GYQSGKTGFR CSKLN. It is sometimes possible for the material contained within the vial of "Putative olfactory receptor 4A8 (OR4A8P), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.