Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Olfactory receptor 1E1 (OR1E1) Recombinant Protein | OR1E1 recombinant protein

Recombinant Human Olfactory receptor 1E1 (OR1E1)

Gene Names
OR1E1; OR1E5; OR1E6; HGM071; OR17-2; OR1E8P; OR1E9P; OST547; OR13-66; OR17-32
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Olfactory receptor 1E1 (OR1E1); Recombinant Human Olfactory receptor 1E1 (OR1E1); Recombinant Olfactory receptor 1E1 (OR1E1); Olfactory receptor 1E1; Olfactory receptor 13-66; OR13-66 Olfactory receptor 17-2/17-32; OR17-2; OR17-32 Olfactory receptor 1E5 Olfactory receptor 1E6 Olfactory receptor 5-85; OR5-85 Olfactory receptor OR17-18 O; OR1E1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-314
Sequence
MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGALSRVIHQKKTFFSL
Sequence Length
314
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,264 Da
NCBI Official Full Name
olfactory receptor 1E1
NCBI Official Synonym Full Names
olfactory receptor, family 1, subfamily E, member 1
NCBI Official Symbol
OR1E1
NCBI Official Synonym Symbols
OR1E5; OR1E6; HGM071; OR17-2; OR1E8P; OR1E9P; OST547; OR13-66; OR17-32
NCBI Protein Information
olfactory receptor 1E1; OR5-85; olfactory receptor 1E5; olfactory receptor 1E6; olfactory receptor 5-85; olfactory receptor 13-66; olfactory receptor OR17-4; olfactory receptor OR17-18; olfactory receptor 17-2/17-32; olfactory receptor-like protein HGMP07I; olfactory receptor, family 1, subfamily E, member 5; olfactory receptor, family 1, subfamily E, member 6; olfactory receptor, family 1, subfamily E, member 8 pseudogene; olfactory receptor, family 1, subfamily E, member 9 pseudogene
UniProt Protein Name
Olfactory receptor 1E1
Protein Family
UniProt Gene Name
OR1E1
UniProt Synonym Gene Names
OR1E5; OR1E6; OR1E9P; OR13-66; OR17-2; OR17-32; OR5-85
UniProt Entry Name
OR1E1_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]

Uniprot Description

OR1E1: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; olfactory receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; sensory perception of smell; detection of chemical stimulus involved in sensory perception of smell

Research Articles on OR1E1

Similar Products

Product Notes

The OR1E1 or1e1 (Catalog #AAA964895) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-314. The amino acid sequence is listed below: MMGQNQTSIS DFLLLGLPIQ PEQQNLCYAL FLAMYLTTLL GNLLIIVLIR LDSHLHTPMY LFLSNLSFSD LCFSSVTIPK LLQNMQNQDP SIPYADCLTQ MYFFLLFGDL ESFLLVAMAY DRYVAICFPL HYTAIMSPML CLALVALSWV LTTFHAMLHT LLMARLCFCA DNVIPHFFCD MSALLKLAFS DTRVNEWVIF IMGGLILVIP FLLILGSYAR IVSSILKVPS SKGICKAFST CGSHLSVVSL FYGTVIGLYL CSSANSSTLK DTVMAMMYTV VTPMLNPFIY SLRNRDMKGA LSRVIHQKKT FFSL. It is sometimes possible for the material contained within the vial of "Olfactory receptor 1E1 (OR1E1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.