Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ABATSample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Rabbit ABAT Polyclonal Antibody | anti-ABAT antibody

ABAT antibody - middle region

Gene Names
ABAT; GABAT; NPD009; GABA-AT
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ABAT; Polyclonal Antibody; ABAT antibody - middle region; anti-ABAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW
Sequence Length
500
Applicable Applications for anti-ABAT antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ABAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ABATSample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ABATSample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ABATSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ABATSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ABAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-ABAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)
Related Product Information for anti-ABAT antibody
This is a rabbit polyclonal antibody against ABAT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. The protein sequence is over 95% similar to the pig protein. GABA is estimated to be present in nearly one-third of human synapses. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
Product Categories/Family for anti-ABAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
18
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
4-aminobutyrate aminotransferase, mitochondrial
NCBI Official Synonym Full Names
4-aminobutyrate aminotransferase
NCBI Official Symbol
ABAT
NCBI Official Synonym Symbols
GABAT; NPD009; GABA-AT
NCBI Protein Information
4-aminobutyrate aminotransferase, mitochondrial
UniProt Protein Name
4-aminobutyrate aminotransferase, mitochondrial
UniProt Gene Name
ABAT
UniProt Synonym Gene Names
GABAT; GABA-AT; GABA transaminase; GABA-T
UniProt Entry Name
GABT_HUMAN

NCBI Description

4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. The protein sequence is over 95% similar to the pig protein. GABA is estimated to be present in nearly one-third of human synapses. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ABAT: Catalyzes the conversion of gamma-aminobutyrate and L- beta-aminoisobutyrate to succinate semialdehyde and methylmalonate semialdehyde, respectively. Can also convert delta-aminovalerate and beta-alanine. Defects in ABAT are a cause of GABA transaminase deficiency (GABATD). The phenotype of this deficiency includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.

Protein type: Amino Acid Metabolism - alanine, aspartate and glutamate; Mitochondrial; Carbohydrate Metabolism - butanoate; EC 2.6.1.19; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Carbohydrate Metabolism - propanoate; Transferase; Other Amino Acids Metabolism - beta-alanine; EC 2.6.1.22

Chromosomal Location of Human Ortholog: 16p13.2

Cellular Component: neuron projection; mitochondrion; mitochondrial matrix; 4-aminobutyrate transaminase complex

Molecular Function: protein homodimerization activity; succinate-semialdehyde dehydrogenase binding; (S)-3-amino-2-methylpropionate transaminase activity; 4-aminobutyrate transaminase activity; pyridoxal phosphate binding

Biological Process: response to nicotine; copulation; response to drug; synaptic transmission; neurotransmitter catabolic process; response to ethanol; behavioral response to cocaine; neurotransmitter secretion; response to hypoxia; locomotory behavior; negative regulation of blood pressure; gamma-aminobutyric acid catabolic process; response to iron ion

Disease: Gaba-transaminase Deficiency

Research Articles on ABAT

Similar Products

Product Notes

The ABAT abat (Catalog #AAA3210420) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABAT antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ABAT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABAT abat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIVEPIQSEG GDNHASDDFF RKLRDIARKH GCAFLVDEVQ TGGGCTGKFW. It is sometimes possible for the material contained within the vial of "ABAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.