Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Outer dense fiber protein 1 (ODF1) Recombinant Protein | ODF1 recombinant protein

Recombinant Human Outer dense fiber protein 1 (ODF1)

Gene Names
ODF1; ODF; RT7; ODF2; ODFP; SODF; CT133; ODF27; ODFPG; HSPB10; ODFPGA; ODFPGB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer dense fiber protein 1 (ODF1); Recombinant Human Outer dense fiber protein 1 (ODF1); ODF1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-250, Full length protein
Sequence
MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLYPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCSPCSPCSPCNPCSPCNPCSPYDPCNPCYPCGSRFSCRKMIL
Sequence Length
250
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ODF1 recombinant protein
The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. The human outer dense fibers contains at least 10 major proteins and this gene encodes the main protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,366 Da
NCBI Official Full Name
outer dense fiber protein 1
NCBI Official Synonym Full Names
outer dense fiber of sperm tails 1
NCBI Official Symbol
ODF1
NCBI Official Synonym Symbols
ODF; RT7; ODF2; ODFP; SODF; CT133; ODF27; ODFPG; HSPB10; ODFPGA; ODFPGB
NCBI Protein Information
outer dense fiber protein 1
UniProt Protein Name
Outer dense fiber protein 1
Protein Family
UniProt Gene Name
ODF1
UniProt Synonym Gene Names
HSPB10; ODFP; HspB10

NCBI Description

The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. The human outer dense fibers contains at least 10 major proteins and this gene encodes the main protein. [provided by RefSeq, Jul 2008]

Uniprot Description

Component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.

Research Articles on ODF1

Similar Products

Product Notes

The ODF1 odf1 (Catalog #AAA1438631) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-250, Full length protein. The amino acid sequence is listed below: MAALSCLLDS VRRDIKKVDR ELRQLRCIDE FSTRCLCDLY MHPYCCCDLH PYPYCLCYSK RSRSCGLCDL YPCCLCDYKL YCLRPSLRSL ERKAIRAIED EKRELAKLRR TTNRILASSC CSSNILGSVN VCGFEPDQVK VRVKDGKVCV SAERENRYDC LGSKKYSYMN ICKEFSLPPC VDEKDVTYSY GLGSCVKIES PCYPCTSPCS PCSPCSPCNP CSPCNPCSPY DPCNPCYPCG SRFSCRKMIL. It is sometimes possible for the material contained within the vial of "Outer dense fiber protein 1 (ODF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.